Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066V1R0

Protein Details
Accession A0A066V1R0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
136-199AAPKPKPKPKPVVKPAPKTKAKPKPKPKAKPKPKAKPKPKAKPKPKAKPKPKPKAAPPKVPPKABasic
NLS Segment(s)
PositionSequence
138-282PKPKPKPKPVVKPAPKTKAKPKPKPKAKPKPKAKPKPKAKPKPKAKPKPKPKAAPPKVPPKAVPKPPPKVPAKAAPKAPAKPPAKAPPKPPAKPPAKAPAGAPAKAPAKAPAKAPAKAPAKAPAKAPAKPPAKAPPKPPAKPPAK
Subcellular Location(s) extr 22, golg 2, mito 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MLLLRFAILPLVATAGVARTEISGAVAAGAGAAAAASSAETPGDRPQGFLAGVQLWTQQLPQLLADAAPFSSPFSSALPFSLARSQRDLPPSEDYVHADSDSSSPAFSSILPLDDHRIEARDASEANNPPSIEFVAAPKPKPKPKPVVKPAPKTKAKPKPKPKAKPKPKAKPKPKAKPKPKAKPKPKPKAAPPKVPPKAVPKPPPKVPAKAAPKAPAKPPAKAPPKPPAKPPAKAPAGAPAKAPAKAPAKAPAKAPAKAPAKAPAKPPAKAPPKPPAKPPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.06
7 0.07
8 0.07
9 0.08
10 0.07
11 0.06
12 0.07
13 0.06
14 0.05
15 0.05
16 0.04
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.03
25 0.03
26 0.04
27 0.04
28 0.06
29 0.11
30 0.18
31 0.17
32 0.19
33 0.19
34 0.22
35 0.22
36 0.21
37 0.19
38 0.13
39 0.14
40 0.13
41 0.13
42 0.11
43 0.11
44 0.11
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.1
51 0.1
52 0.1
53 0.08
54 0.07
55 0.07
56 0.07
57 0.06
58 0.07
59 0.07
60 0.08
61 0.09
62 0.1
63 0.1
64 0.11
65 0.13
66 0.13
67 0.14
68 0.2
69 0.22
70 0.22
71 0.27
72 0.28
73 0.3
74 0.35
75 0.36
76 0.32
77 0.33
78 0.33
79 0.3
80 0.29
81 0.27
82 0.24
83 0.22
84 0.19
85 0.14
86 0.13
87 0.11
88 0.12
89 0.09
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.08
96 0.07
97 0.08
98 0.09
99 0.1
100 0.12
101 0.12
102 0.13
103 0.11
104 0.12
105 0.11
106 0.11
107 0.11
108 0.09
109 0.09
110 0.1
111 0.15
112 0.16
113 0.17
114 0.18
115 0.18
116 0.16
117 0.17
118 0.15
119 0.1
120 0.09
121 0.09
122 0.15
123 0.17
124 0.18
125 0.22
126 0.27
127 0.34
128 0.39
129 0.44
130 0.47
131 0.55
132 0.65
133 0.69
134 0.74
135 0.76
136 0.81
137 0.83
138 0.82
139 0.79
140 0.73
141 0.75
142 0.74
143 0.76
144 0.77
145 0.79
146 0.8
147 0.85
148 0.91
149 0.92
150 0.93
151 0.93
152 0.93
153 0.93
154 0.93
155 0.94
156 0.94
157 0.94
158 0.93
159 0.93
160 0.93
161 0.94
162 0.94
163 0.93
164 0.93
165 0.93
166 0.93
167 0.94
168 0.94
169 0.94
170 0.94
171 0.94
172 0.95
173 0.93
174 0.91
175 0.9
176 0.91
177 0.88
178 0.87
179 0.83
180 0.83
181 0.79
182 0.73
183 0.66
184 0.64
185 0.66
186 0.64
187 0.67
188 0.65
189 0.68
190 0.71
191 0.76
192 0.71
193 0.68
194 0.64
195 0.64
196 0.63
197 0.61
198 0.59
199 0.58
200 0.6
201 0.58
202 0.58
203 0.58
204 0.52
205 0.5
206 0.53
207 0.56
208 0.58
209 0.6
210 0.61
211 0.62
212 0.69
213 0.69
214 0.68
215 0.68
216 0.67
217 0.66
218 0.67
219 0.67
220 0.61
221 0.58
222 0.51
223 0.51
224 0.49
225 0.44
226 0.38
227 0.35
228 0.33
229 0.34
230 0.34
231 0.31
232 0.32
233 0.33
234 0.35
235 0.38
236 0.41
237 0.42
238 0.44
239 0.46
240 0.46
241 0.46
242 0.46
243 0.46
244 0.46
245 0.46
246 0.46
247 0.46
248 0.46
249 0.48
250 0.51
251 0.52
252 0.52
253 0.51
254 0.55
255 0.56
256 0.59
257 0.6
258 0.61
259 0.61
260 0.65
261 0.67
262 0.68