Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066WNP8

Protein Details
Accession A0A066WNP8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAKSKNHTNHNQNKKAHRNGIKKPKTNKYPSHydrophilic
NLS Segment(s)
PositionSequence
14-34KKAHRNGIKKPKTNKYPSLKG
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPKTNKYPSLKGVDPKFVRNQRYAKHGSEKAARLAKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.8
7 0.84
8 0.84
9 0.82
10 0.82
11 0.82
12 0.82
13 0.8
14 0.79
15 0.76
16 0.74
17 0.7
18 0.67
19 0.59
20 0.56
21 0.51
22 0.51
23 0.44
24 0.4
25 0.45
26 0.46
27 0.47
28 0.48
29 0.52
30 0.47
31 0.53
32 0.55
33 0.51
34 0.54
35 0.54
36 0.53
37 0.55
38 0.55
39 0.54
40 0.56
41 0.5