Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BZW8

Protein Details
Accession Q6BZW8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
197-216NEKIREEKAARGKKKKPGLABasic
NLS Segment(s)
PositionSequence
201-214REEKAARGKKKKPG
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023194  eIF3-like_dom_sf  
IPR013906  eIF3j  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
KEGG yli:YALI0F30305g  -  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences MASWDDEDFEVPAAATPAVPANWDDDEEEDVMDSWDAEEPTKAPGPKTTVAAPKKAQRQQIAKIEREMAAMKLKPEDASTKRDRQRQAELDSDMMNASELFGGTGGIADSAAKAEAAPAPAAPAAPMKLSDLAIFHPKEKKDFTNLKETLAPILTDLNKTSPLAYPDFAITFTKALAEPLKVEQLRKLISTLNAYQNEKIREEKAARGKKKKPGLAAASAKINDDKDTSTFNDNFDDFDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.09
5 0.09
6 0.1
7 0.1
8 0.12
9 0.13
10 0.14
11 0.14
12 0.14
13 0.16
14 0.15
15 0.15
16 0.11
17 0.11
18 0.1
19 0.09
20 0.08
21 0.06
22 0.09
23 0.09
24 0.09
25 0.1
26 0.1
27 0.14
28 0.19
29 0.19
30 0.18
31 0.22
32 0.27
33 0.29
34 0.31
35 0.33
36 0.38
37 0.4
38 0.45
39 0.46
40 0.47
41 0.55
42 0.57
43 0.58
44 0.57
45 0.61
46 0.63
47 0.68
48 0.67
49 0.6
50 0.57
51 0.53
52 0.45
53 0.4
54 0.32
55 0.24
56 0.23
57 0.21
58 0.2
59 0.18
60 0.18
61 0.17
62 0.18
63 0.23
64 0.21
65 0.28
66 0.33
67 0.41
68 0.47
69 0.53
70 0.57
71 0.55
72 0.61
73 0.6
74 0.58
75 0.53
76 0.49
77 0.43
78 0.38
79 0.33
80 0.23
81 0.16
82 0.12
83 0.07
84 0.06
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.14
121 0.14
122 0.15
123 0.19
124 0.2
125 0.23
126 0.25
127 0.26
128 0.29
129 0.36
130 0.37
131 0.43
132 0.43
133 0.41
134 0.4
135 0.38
136 0.31
137 0.25
138 0.21
139 0.11
140 0.14
141 0.13
142 0.12
143 0.12
144 0.11
145 0.12
146 0.12
147 0.13
148 0.12
149 0.14
150 0.15
151 0.15
152 0.14
153 0.14
154 0.15
155 0.15
156 0.14
157 0.12
158 0.1
159 0.1
160 0.1
161 0.09
162 0.1
163 0.11
164 0.11
165 0.11
166 0.13
167 0.21
168 0.21
169 0.21
170 0.23
171 0.26
172 0.27
173 0.26
174 0.25
175 0.21
176 0.22
177 0.27
178 0.28
179 0.32
180 0.35
181 0.37
182 0.39
183 0.42
184 0.42
185 0.39
186 0.38
187 0.32
188 0.34
189 0.35
190 0.4
191 0.44
192 0.51
193 0.59
194 0.66
195 0.72
196 0.74
197 0.81
198 0.79
199 0.75
200 0.75
201 0.71
202 0.71
203 0.7
204 0.64
205 0.6
206 0.55
207 0.49
208 0.42
209 0.37
210 0.29
211 0.24
212 0.23
213 0.19
214 0.22
215 0.24
216 0.28
217 0.28
218 0.28
219 0.31
220 0.28
221 0.28
222 0.26