Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CC79

Protein Details
Accession Q6CC79    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKDASAPRRTRKTTGKKKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
8-27PRRTRKTTGKKKKDPNAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
KEGG yli:YALI0C11671g  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKDASAPRRTRKTTGKKKKDPNAPKRALSAYMFFANDNRDAIRADNPGIAFGQVGKALGEKWKTLTDAEKVPYEEKATADKKRYEDEKAAYKANAAEFDEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.85
4 0.85
5 0.91
6 0.92
7 0.92
8 0.92
9 0.92
10 0.91
11 0.86
12 0.79
13 0.73
14 0.65
15 0.58
16 0.48
17 0.4
18 0.31
19 0.27
20 0.25
21 0.2
22 0.19
23 0.18
24 0.16
25 0.15
26 0.12
27 0.1
28 0.11
29 0.12
30 0.13
31 0.12
32 0.13
33 0.14
34 0.13
35 0.13
36 0.12
37 0.11
38 0.08
39 0.07
40 0.06
41 0.05
42 0.05
43 0.04
44 0.04
45 0.05
46 0.09
47 0.1
48 0.09
49 0.12
50 0.13
51 0.14
52 0.15
53 0.18
54 0.17
55 0.2
56 0.22
57 0.23
58 0.23
59 0.23
60 0.24
61 0.23
62 0.21
63 0.18
64 0.24
65 0.27
66 0.31
67 0.37
68 0.4
69 0.41
70 0.47
71 0.49
72 0.48
73 0.49
74 0.49
75 0.52
76 0.51
77 0.52
78 0.44
79 0.42
80 0.39
81 0.35
82 0.33
83 0.25