Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066VU80

Protein Details
Accession A0A066VU80    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-82PICQQRLCGHRRRRRHPHRHRHQPPKQPLQLRQHERVRRWRQPRIPRSQEQBasic
NLS Segment(s)
PositionSequence
41-76HRRRRRHPHRHRHQPPKQPLQLRQHERVRRWRQPRI
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MHRIARRAHRLQLQHLRVHLGRRQPQVRRLLPICQQRLCGHRRRRRHPHRHRHQPPKQPLQLRQHERVRRWRQPRIPRSQEQQHSRQRPAPVSDPTAPPPFGTAIATTEKMTKKCGFGKFLGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.56
4 0.5
5 0.51
6 0.45
7 0.44
8 0.46
9 0.51
10 0.58
11 0.59
12 0.64
13 0.68
14 0.67
15 0.65
16 0.6
17 0.57
18 0.56
19 0.59
20 0.57
21 0.49
22 0.5
23 0.45
24 0.49
25 0.49
26 0.51
27 0.53
28 0.55
29 0.64
30 0.71
31 0.79
32 0.84
33 0.89
34 0.91
35 0.91
36 0.94
37 0.95
38 0.95
39 0.95
40 0.93
41 0.92
42 0.9
43 0.88
44 0.84
45 0.78
46 0.76
47 0.73
48 0.74
49 0.69
50 0.67
51 0.66
52 0.65
53 0.64
54 0.67
55 0.67
56 0.67
57 0.7
58 0.72
59 0.73
60 0.78
61 0.82
62 0.82
63 0.81
64 0.77
65 0.77
66 0.77
67 0.76
68 0.72
69 0.72
70 0.71
71 0.7
72 0.69
73 0.66
74 0.61
75 0.57
76 0.56
77 0.52
78 0.47
79 0.46
80 0.45
81 0.43
82 0.43
83 0.42
84 0.37
85 0.31
86 0.28
87 0.23
88 0.21
89 0.18
90 0.15
91 0.13
92 0.17
93 0.18
94 0.17
95 0.22
96 0.27
97 0.27
98 0.32
99 0.32
100 0.35
101 0.41
102 0.47
103 0.46