Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066W7C6

Protein Details
Accession A0A066W7C6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-36VTTSRRTRPIQQMKCRGKPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009567  SARAF  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006816  P:calcium ion transport  
GO:2001256  P:regulation of store-operated calcium entry  
Pfam View protein in Pfam  
PF06682  SARAF  
Amino Acid Sequences RMHISNLRALTFYSNAVTTSRRTRPIQQMKCRGKPCGSYQPDVISCQAIGSSGGVGPEWTCQADMPSSIRLGRVQVSCEGWDNPQDAYILKGKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.17
5 0.17
6 0.24
7 0.28
8 0.33
9 0.36
10 0.43
11 0.53
12 0.62
13 0.69
14 0.71
15 0.76
16 0.79
17 0.84
18 0.79
19 0.73
20 0.65
21 0.6
22 0.57
23 0.57
24 0.52
25 0.45
26 0.43
27 0.43
28 0.41
29 0.37
30 0.3
31 0.19
32 0.15
33 0.13
34 0.11
35 0.07
36 0.06
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.08
51 0.09
52 0.1
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.14
59 0.18
60 0.18
61 0.19
62 0.21
63 0.22
64 0.23
65 0.25
66 0.24
67 0.21
68 0.23
69 0.21
70 0.19
71 0.17
72 0.17
73 0.14
74 0.16