Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QFG6

Protein Details
Accession B6QFG6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-37GTPNQAKKPHTKTPAKTPAKQKVKKANAPKTPHydrophilic
NLS Segment(s)
PositionSequence
12-42KKPHTKTPAKTPAKQKVKKANAPKTPGSRKG
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 9, cyto 7.5
Family & Domain DBs
KEGG tmf:PMAA_082070  -  
Amino Acid Sequences MATPGGTPNQAKKPHTKTPAKTPAKQKVKKANAPKTPGSRKGFGNHGWKHEIMAMSLEDLPRIIRDYDTTERAEHQHDLIASCLKRILRDLKLNSNHEPREE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.69
3 0.72
4 0.69
5 0.73
6 0.81
7 0.78
8 0.78
9 0.78
10 0.79
11 0.8
12 0.8
13 0.79
14 0.78
15 0.81
16 0.82
17 0.82
18 0.81
19 0.79
20 0.78
21 0.76
22 0.74
23 0.72
24 0.73
25 0.66
26 0.59
27 0.53
28 0.51
29 0.49
30 0.45
31 0.48
32 0.41
33 0.4
34 0.4
35 0.37
36 0.35
37 0.32
38 0.26
39 0.16
40 0.14
41 0.11
42 0.09
43 0.1
44 0.09
45 0.07
46 0.06
47 0.06
48 0.06
49 0.08
50 0.07
51 0.07
52 0.08
53 0.15
54 0.19
55 0.22
56 0.23
57 0.22
58 0.24
59 0.25
60 0.27
61 0.22
62 0.18
63 0.18
64 0.17
65 0.17
66 0.17
67 0.21
68 0.18
69 0.17
70 0.2
71 0.18
72 0.18
73 0.23
74 0.29
75 0.31
76 0.4
77 0.46
78 0.53
79 0.61
80 0.65
81 0.67
82 0.69