Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066WHP6

Protein Details
Accession A0A066WHP6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRERCFTRKRRAAHVKQGCCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 4, extr 3
Family & Domain DBs
Amino Acid Sequences MRERCFTRKRRAAHVKQGCCLIEAEPYLCLLHSPLWPNDSTVAPGDNRRSAGDRLQYLAHKAGPLDVASRPVCHSLFSLRHVLGSRHASSHPGARIDRWKPAVRICSSRPTPAECGHGHTFDHFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.79
3 0.73
4 0.74
5 0.63
6 0.53
7 0.44
8 0.33
9 0.26
10 0.21
11 0.19
12 0.13
13 0.13
14 0.12
15 0.11
16 0.11
17 0.08
18 0.09
19 0.12
20 0.15
21 0.16
22 0.18
23 0.18
24 0.19
25 0.2
26 0.18
27 0.16
28 0.13
29 0.14
30 0.13
31 0.16
32 0.18
33 0.18
34 0.18
35 0.18
36 0.21
37 0.21
38 0.24
39 0.25
40 0.23
41 0.22
42 0.23
43 0.23
44 0.21
45 0.21
46 0.17
47 0.13
48 0.12
49 0.11
50 0.09
51 0.09
52 0.09
53 0.08
54 0.11
55 0.11
56 0.12
57 0.12
58 0.14
59 0.14
60 0.13
61 0.14
62 0.15
63 0.17
64 0.2
65 0.22
66 0.2
67 0.22
68 0.22
69 0.22
70 0.22
71 0.25
72 0.23
73 0.22
74 0.22
75 0.22
76 0.22
77 0.27
78 0.25
79 0.24
80 0.24
81 0.26
82 0.35
83 0.35
84 0.41
85 0.42
86 0.44
87 0.43
88 0.49
89 0.53
90 0.49
91 0.53
92 0.5
93 0.54
94 0.52
95 0.56
96 0.52
97 0.49
98 0.5
99 0.46
100 0.48
101 0.39
102 0.43
103 0.4
104 0.39
105 0.35