FuNGI

A0A067QBF0

Protein Details

Accession

A0A067QBF0

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
430-452	WTPTNPSPSHRARRQNHGREEED	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 15, mito 7, cyto 2, extr 1, cyto_nucl 1, pero 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR042321 Ima1 IPR018617 Ima1_N
Gene Ontology	GO:0005637 C:nuclear inner membrane GO:0071765 P:nuclear inner membrane organization
Pfam	View protein in Pfam PF09779 Ima1_N

Amino Acid Sequences

MASLIRRPTSVSCFFCNTPIVPLPQNPRSFRCPHCQCWNRFDANGDIMSDEPAMHDEALNARSFAKRASPSKDRFTTAYSKGPFCHDCTTNQMLLTNLLANYLPPTTSPDYARRLEMLPEYKESLYRRYPPVCASCAPAVEDAIKSKDHMARTSALGGWLKESKGKGKQRQTSVVPDEGEKVKRELTFWRVRGGLWVFSLATVMICDTSVALGYRIPFPITLFQPILPIISVASVLWTAWDPTYHTFRTAKHQGRAVRVQGKRYYDILQILAWLLRTISSILIAIPFYSPSQDPLQLHRTLDLSHETSLSTRSRIYFSISLFIELSIFITSCFVLRLHQPPPIRLIETDSHKRASLTPAPEFPPSPNGVLSHAQADPDLLATLSLSSNPILTASSQQKSNPIFGLPSLLSQNVPTTPPPRQKDYEDEMDWTPTNPSPSHRARRQNHGREEEDDGAWLKPQRFFPPEKPTGLENLFPRIKLVDETEQGQGSQQSSGGSNYLSKWKLW

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.45
2	0.45
3	0.44
4	0.37
5	0.34
6	0.34
7	0.34
8	0.32
9	0.38
10	0.43
11	0.48
12	0.55
13	0.53
14	0.55
15	0.58
16	0.61
17	0.61
18	0.63
19	0.63
20	0.64
21	0.7
22	0.74
23	0.73
24	0.75
25	0.77
26	0.7
27	0.64
28	0.58
29	0.52
30	0.46
31	0.41
32	0.33
33	0.26
34	0.21
35	0.21
36	0.18
37	0.13
38	0.09
39	0.1
40	0.1
41	0.1
42	0.09
43	0.1
44	0.13
45	0.15
46	0.15
47	0.14
48	0.15
49	0.16
50	0.17
51	0.17
52	0.21
53	0.27
54	0.33
55	0.41
56	0.49
57	0.53
58	0.62
59	0.65
60	0.61
61	0.56
62	0.55
63	0.54
64	0.49
65	0.52
66	0.46
67	0.44
68	0.42
69	0.46
70	0.43
71	0.39
72	0.41
73	0.35
74	0.33
75	0.38
76	0.42
77	0.37
78	0.35
79	0.32
80	0.26
81	0.25
82	0.23
83	0.18
84	0.12
85	0.11
86	0.11
87	0.1
88	0.11
89	0.1
90	0.09
91	0.07
92	0.14
93	0.16
94	0.19
95	0.23
96	0.28
97	0.33
98	0.35
99	0.36
100	0.32
101	0.3
102	0.3
103	0.33
104	0.32
105	0.29
106	0.3
107	0.31
108	0.29
109	0.33
110	0.32
111	0.32
112	0.32
113	0.36
114	0.4
115	0.4
116	0.42
117	0.44
118	0.46
119	0.43
120	0.38
121	0.37
122	0.32
123	0.3
124	0.29
125	0.23
126	0.19
127	0.17
128	0.17
129	0.14
130	0.14
131	0.14
132	0.13
133	0.17
134	0.2
135	0.21
136	0.22
137	0.23
138	0.23
139	0.24
140	0.26
141	0.21
142	0.2
143	0.2
144	0.18
145	0.18
146	0.18
147	0.17
148	0.18
149	0.19
150	0.23
151	0.31
152	0.4
153	0.46
154	0.54
155	0.62
156	0.65
157	0.7
158	0.68
159	0.67
160	0.61
161	0.56
162	0.47
163	0.4
164	0.37
165	0.34
166	0.32
167	0.25
168	0.22
169	0.21
170	0.21
171	0.22
172	0.23
173	0.27
174	0.34
175	0.33
176	0.35
177	0.32
178	0.32
179	0.36
180	0.33
181	0.26
182	0.18
183	0.17
184	0.14
185	0.13
186	0.13
187	0.08
188	0.06
189	0.05
190	0.04
191	0.03
192	0.03
193	0.03
194	0.03
195	0.03
196	0.04
197	0.04
198	0.04
199	0.05
200	0.06
201	0.08
202	0.08
203	0.09
204	0.08
205	0.09
206	0.13
207	0.13
208	0.15
209	0.14
210	0.14
211	0.15
212	0.15
213	0.14
214	0.1
215	0.09
216	0.05
217	0.05
218	0.05
219	0.04
220	0.04
221	0.04
222	0.03
223	0.04
224	0.04
225	0.04
226	0.04
227	0.05
228	0.06
229	0.09
230	0.13
231	0.13
232	0.16
233	0.18
234	0.19
235	0.27
236	0.35
237	0.38
238	0.37
239	0.41
240	0.43
241	0.46
242	0.49
243	0.47
244	0.46
245	0.42
246	0.44
247	0.43
248	0.42
249	0.39
250	0.37
251	0.34
252	0.27
253	0.26
254	0.22
255	0.17
256	0.15
257	0.13
258	0.11
259	0.08
260	0.06
261	0.05
262	0.04
263	0.05
264	0.05
265	0.05
266	0.05
267	0.05
268	0.05
269	0.06
270	0.05
271	0.05
272	0.05
273	0.05
274	0.05
275	0.07
276	0.07
277	0.09
278	0.11
279	0.15
280	0.16
281	0.2
282	0.25
283	0.25
284	0.25
285	0.24
286	0.22
287	0.19
288	0.2
289	0.18
290	0.15
291	0.14
292	0.14
293	0.13
294	0.12
295	0.15
296	0.15
297	0.12
298	0.12
299	0.13
300	0.15
301	0.15
302	0.2
303	0.19
304	0.19
305	0.23
306	0.22
307	0.22
308	0.2
309	0.19
310	0.14
311	0.11
312	0.11
313	0.06
314	0.06
315	0.05
316	0.05
317	0.05
318	0.05
319	0.06
320	0.06
321	0.07
322	0.11
323	0.16
324	0.17
325	0.23
326	0.25
327	0.25
328	0.3
329	0.31
330	0.28
331	0.24
332	0.27
333	0.26
334	0.32
335	0.38
336	0.36
337	0.35
338	0.34
339	0.34
340	0.31
341	0.33
342	0.32
343	0.3
344	0.31
345	0.33
346	0.35
347	0.36
348	0.35
349	0.3
350	0.28
351	0.25
352	0.23
353	0.21
354	0.19
355	0.21
356	0.22
357	0.21
358	0.19
359	0.17
360	0.16
361	0.15
362	0.14
363	0.11
364	0.09
365	0.08
366	0.05
367	0.05
368	0.05
369	0.06
370	0.05
371	0.06
372	0.06
373	0.06
374	0.06
375	0.06
376	0.07
377	0.06
378	0.07
379	0.14
380	0.19
381	0.22
382	0.23
383	0.24
384	0.31
385	0.32
386	0.34
387	0.28
388	0.23
389	0.22
390	0.2
391	0.24
392	0.17
393	0.18
394	0.17
395	0.16
396	0.15
397	0.15
398	0.17
399	0.14
400	0.15
401	0.17
402	0.19
403	0.27
404	0.36
405	0.41
406	0.46
407	0.49
408	0.52
409	0.57
410	0.6
411	0.59
412	0.51
413	0.5
414	0.44
415	0.43
416	0.39
417	0.31
418	0.27
419	0.21
420	0.23
421	0.2
422	0.23
423	0.28
424	0.37
425	0.47
426	0.53
427	0.62
428	0.64
429	0.74
430	0.82
431	0.83
432	0.84
433	0.82
434	0.76
435	0.69
436	0.7
437	0.63
438	0.52
439	0.43
440	0.34
441	0.27
442	0.26
443	0.27
444	0.23
445	0.25
446	0.29
447	0.35
448	0.4
449	0.46
450	0.52
451	0.58
452	0.61
453	0.6
454	0.58
455	0.52
456	0.54
457	0.5
458	0.46
459	0.38
460	0.41
461	0.39
462	0.36
463	0.35
464	0.29
465	0.28
466	0.25
467	0.29
468	0.27
469	0.27
470	0.3
471	0.32
472	0.32
473	0.3
474	0.29
475	0.26
476	0.2
477	0.18
478	0.17
479	0.15
480	0.15
481	0.17
482	0.16
483	0.14
484	0.15
485	0.17
486	0.25

A0A067QBF0

3D AlphaFold-predicted Structure Viewer