Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QEL9

Protein Details
Accession B6QEL9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
108-131MVGLKKRDRSAKKKGKAKTKSGKABasic
NLS Segment(s)
PositionSequence
112-131KKRDRSAKKKGKAKTKSGKA
Subcellular Location(s) nucl 10.5, cyto_nucl 8.5, mito 7, cyto 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG tmf:PMAA_089600  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MAPHLSNDEFFASLTTLLTSTSKKTQGSVYLTQKRLTSSSTDPSITEGSILVRATDGKTQNPKPSKTTDNTKVTKKKAAPKSKLSTVVSPADLEAFFVKYADICKAGMVGLKKRDRSAKKKGKAKTKSGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.08
4 0.08
5 0.1
6 0.11
7 0.14
8 0.19
9 0.23
10 0.23
11 0.25
12 0.27
13 0.32
14 0.37
15 0.41
16 0.46
17 0.51
18 0.52
19 0.52
20 0.5
21 0.45
22 0.4
23 0.33
24 0.28
25 0.23
26 0.26
27 0.27
28 0.27
29 0.25
30 0.26
31 0.25
32 0.2
33 0.16
34 0.11
35 0.09
36 0.1
37 0.1
38 0.07
39 0.07
40 0.07
41 0.08
42 0.13
43 0.14
44 0.16
45 0.23
46 0.26
47 0.34
48 0.39
49 0.4
50 0.38
51 0.42
52 0.43
53 0.4
54 0.45
55 0.46
56 0.49
57 0.51
58 0.57
59 0.59
60 0.57
61 0.6
62 0.57
63 0.58
64 0.6
65 0.67
66 0.65
67 0.67
68 0.71
69 0.69
70 0.71
71 0.64
72 0.56
73 0.5
74 0.45
75 0.37
76 0.3
77 0.24
78 0.18
79 0.15
80 0.14
81 0.1
82 0.09
83 0.08
84 0.08
85 0.08
86 0.07
87 0.09
88 0.1
89 0.1
90 0.09
91 0.09
92 0.09
93 0.1
94 0.13
95 0.16
96 0.2
97 0.28
98 0.35
99 0.38
100 0.42
101 0.52
102 0.59
103 0.63
104 0.69
105 0.7
106 0.74
107 0.8
108 0.84
109 0.85
110 0.84
111 0.86