Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PT04

Protein Details
Accession A0A067PT04   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
179-199EEDRERHKRLREKRWVQPVSHBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5.5, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006569  CID_dom  
IPR042326  Ctk3  
IPR024637  Ctk3_C  
IPR024638  Ctk3_N  
IPR008942  ENTH_VHS  
Gene Ontology GO:0070692  C:CTDK-1 complex  
GO:0032786  P:positive regulation of DNA-templated transcription, elongation  
Pfam View protein in Pfam  
PF12243  CTK3  
PF12350  CTK3_C  
PROSITE View protein in PROSITE  
PS51391  CID  
Amino Acid Sequences MDPFEVRMQFLSLMRRLNASQPSIQKVVGYALKYFSRCGEDLWDCIIEECQKGSINHRINILYFLDSLCEACLQAKTHPSSIGYDGSSTNFYVDFVAQDLAKIVENVVPEGRQGLPNLSSTKQILSNWRNKRVIDPQKVDEVITTLNSRKSAEEEAPASTEAPSASSRLSKTDIFRRIEEDRERHKRLREKRWVQPVSHNPQSHLPPQLASFLPLTDDGDGEEELTLDIEFENEWETTSDWNEDDDDAVGEENVLCFPGEGEKPMDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.3
4 0.34
5 0.37
6 0.35
7 0.37
8 0.39
9 0.44
10 0.43
11 0.42
12 0.35
13 0.3
14 0.31
15 0.29
16 0.25
17 0.2
18 0.22
19 0.26
20 0.27
21 0.27
22 0.24
23 0.25
24 0.24
25 0.24
26 0.28
27 0.26
28 0.27
29 0.28
30 0.26
31 0.21
32 0.21
33 0.22
34 0.17
35 0.15
36 0.14
37 0.13
38 0.16
39 0.17
40 0.22
41 0.3
42 0.33
43 0.35
44 0.37
45 0.37
46 0.34
47 0.36
48 0.32
49 0.23
50 0.17
51 0.15
52 0.13
53 0.12
54 0.11
55 0.09
56 0.08
57 0.06
58 0.07
59 0.1
60 0.11
61 0.13
62 0.19
63 0.21
64 0.22
65 0.23
66 0.23
67 0.23
68 0.24
69 0.24
70 0.18
71 0.17
72 0.16
73 0.16
74 0.16
75 0.13
76 0.11
77 0.09
78 0.09
79 0.09
80 0.08
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.06
91 0.07
92 0.07
93 0.08
94 0.08
95 0.07
96 0.07
97 0.09
98 0.09
99 0.08
100 0.09
101 0.09
102 0.1
103 0.13
104 0.15
105 0.14
106 0.15
107 0.14
108 0.15
109 0.16
110 0.16
111 0.23
112 0.26
113 0.35
114 0.4
115 0.48
116 0.49
117 0.47
118 0.5
119 0.52
120 0.56
121 0.55
122 0.52
123 0.46
124 0.47
125 0.47
126 0.43
127 0.32
128 0.23
129 0.15
130 0.12
131 0.12
132 0.1
133 0.11
134 0.11
135 0.12
136 0.12
137 0.14
138 0.15
139 0.15
140 0.16
141 0.16
142 0.16
143 0.16
144 0.16
145 0.14
146 0.11
147 0.11
148 0.08
149 0.08
150 0.08
151 0.08
152 0.08
153 0.1
154 0.11
155 0.13
156 0.16
157 0.17
158 0.21
159 0.29
160 0.36
161 0.36
162 0.37
163 0.4
164 0.39
165 0.43
166 0.46
167 0.45
168 0.47
169 0.54
170 0.59
171 0.59
172 0.64
173 0.67
174 0.7
175 0.74
176 0.75
177 0.74
178 0.77
179 0.83
180 0.8
181 0.73
182 0.73
183 0.72
184 0.69
185 0.69
186 0.61
187 0.52
188 0.53
189 0.55
190 0.48
191 0.42
192 0.34
193 0.27
194 0.27
195 0.29
196 0.23
197 0.21
198 0.17
199 0.14
200 0.14
201 0.14
202 0.14
203 0.1
204 0.1
205 0.08
206 0.1
207 0.09
208 0.09
209 0.08
210 0.07
211 0.06
212 0.07
213 0.06
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.07
220 0.06
221 0.07
222 0.08
223 0.09
224 0.11
225 0.13
226 0.14
227 0.13
228 0.14
229 0.14
230 0.13
231 0.14
232 0.12
233 0.11
234 0.1
235 0.1
236 0.08
237 0.08
238 0.07
239 0.07
240 0.06
241 0.06
242 0.06
243 0.05
244 0.06
245 0.12
246 0.13
247 0.15
248 0.17