Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PKJ5

Protein Details
Accession A0A067PKJ5   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-23ANSKSKMTGKGKHKRPIPSHEPBasic
NLS Segment(s)
PositionSequence
11-15KGKHK
119-124RKKKPA
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MANSKSKMTGKGKHKRPIPSHEPDGTSSNESDEDSRPPVKKTRTSIKGGVSTPNSPRKDGSSSGKVPVTKSSGGGAKRAAKVDVETAPSSEPSPKASDKSKRVTSSTQKAGVAEGNSQRKKKPAPARSPTPSEAEEIAGNFDLYRMNLSSLHSVFLAKESKPGDTTRNRDYEGLYMKIMELQVKNTHTAQIYLPPFSESKFSDDESEPSRPGPKAQRFDPEVLGRLSSTSFQDPMAEEPYDISITALKSQPDLKFNLSERCYFGSKMFKSSSISHTIPGILGATRLAASHCGVDHASGDFKIRGPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.81
5 0.8
6 0.78
7 0.77
8 0.73
9 0.69
10 0.62
11 0.57
12 0.5
13 0.44
14 0.35
15 0.29
16 0.24
17 0.22
18 0.22
19 0.21
20 0.21
21 0.22
22 0.28
23 0.29
24 0.32
25 0.39
26 0.44
27 0.5
28 0.55
29 0.61
30 0.62
31 0.67
32 0.69
33 0.67
34 0.66
35 0.6
36 0.59
37 0.52
38 0.5
39 0.51
40 0.54
41 0.49
42 0.44
43 0.44
44 0.41
45 0.42
46 0.42
47 0.42
48 0.42
49 0.43
50 0.45
51 0.47
52 0.44
53 0.41
54 0.4
55 0.37
56 0.29
57 0.27
58 0.26
59 0.27
60 0.27
61 0.27
62 0.28
63 0.29
64 0.31
65 0.32
66 0.3
67 0.25
68 0.25
69 0.27
70 0.25
71 0.22
72 0.19
73 0.19
74 0.19
75 0.19
76 0.18
77 0.18
78 0.16
79 0.14
80 0.18
81 0.2
82 0.23
83 0.3
84 0.38
85 0.42
86 0.5
87 0.54
88 0.53
89 0.55
90 0.6
91 0.61
92 0.6
93 0.59
94 0.54
95 0.48
96 0.44
97 0.42
98 0.36
99 0.28
100 0.23
101 0.24
102 0.29
103 0.33
104 0.34
105 0.35
106 0.38
107 0.4
108 0.45
109 0.49
110 0.5
111 0.56
112 0.62
113 0.7
114 0.7
115 0.72
116 0.64
117 0.57
118 0.48
119 0.39
120 0.32
121 0.24
122 0.19
123 0.14
124 0.13
125 0.09
126 0.08
127 0.06
128 0.06
129 0.05
130 0.05
131 0.06
132 0.05
133 0.06
134 0.07
135 0.08
136 0.11
137 0.11
138 0.12
139 0.11
140 0.11
141 0.1
142 0.12
143 0.13
144 0.1
145 0.14
146 0.14
147 0.15
148 0.16
149 0.18
150 0.22
151 0.26
152 0.31
153 0.32
154 0.35
155 0.35
156 0.34
157 0.34
158 0.32
159 0.29
160 0.26
161 0.2
162 0.17
163 0.16
164 0.16
165 0.16
166 0.14
167 0.11
168 0.12
169 0.16
170 0.17
171 0.19
172 0.18
173 0.2
174 0.17
175 0.18
176 0.16
177 0.2
178 0.2
179 0.19
180 0.19
181 0.18
182 0.18
183 0.17
184 0.19
185 0.13
186 0.16
187 0.17
188 0.17
189 0.2
190 0.21
191 0.23
192 0.24
193 0.25
194 0.22
195 0.21
196 0.24
197 0.21
198 0.25
199 0.32
200 0.37
201 0.4
202 0.43
203 0.5
204 0.5
205 0.52
206 0.52
207 0.45
208 0.39
209 0.34
210 0.31
211 0.23
212 0.19
213 0.17
214 0.13
215 0.14
216 0.13
217 0.13
218 0.13
219 0.14
220 0.14
221 0.16
222 0.18
223 0.16
224 0.14
225 0.14
226 0.15
227 0.14
228 0.13
229 0.11
230 0.1
231 0.1
232 0.14
233 0.15
234 0.14
235 0.16
236 0.21
237 0.25
238 0.26
239 0.28
240 0.28
241 0.32
242 0.35
243 0.42
244 0.39
245 0.38
246 0.38
247 0.39
248 0.38
249 0.34
250 0.35
251 0.36
252 0.35
253 0.39
254 0.37
255 0.36
256 0.38
257 0.41
258 0.41
259 0.39
260 0.38
261 0.33
262 0.32
263 0.3
264 0.26
265 0.22
266 0.18
267 0.11
268 0.1
269 0.09
270 0.08
271 0.08
272 0.08
273 0.08
274 0.09
275 0.1
276 0.12
277 0.12
278 0.13
279 0.14
280 0.14
281 0.14
282 0.14
283 0.16
284 0.15
285 0.18
286 0.17