Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PBC3

Protein Details
Accession A0A067PBC3   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
231-259DWTPPAKAKGVKRAKRKDSKMDQKAKGAAHydrophilic
NLS Segment(s)
PositionSequence
236-275AKAKGVKRAKRKDSKMDQKAKGAAHVSRLRRATAGRRPRR
Subcellular Location(s) cyto 15.5, cyto_mito 11, mito 5.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046520  DUF6697  
Pfam View protein in Pfam  
PF20411  DUF6697  
Amino Acid Sequences MSKSRLKIDSAGTVYERIRTIGFEPYPITLDEGIKDVKVPRAFVSNLFGGNPQKTFPEVASERVQQHGYDNFMMLNCNYNPEAPKYPGSPGLFYSPRAETRPEQRVFVGIKPKEFGYKGQYELVEVDSLTSDEFTSQSNAFKRTWAKGIMDNKWGREIRTRIILRRRLHREPTKREFEKAMEAGFTHQDLTESEIENAYVVGQEKIFLYALKCVGYDEGFQRTIADAYTPDWTPPAKAKGVKRAKRKDSKMDQKAKGAAHVSRLRRATAGRRPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.29
4 0.22
5 0.2
6 0.19
7 0.19
8 0.24
9 0.24
10 0.23
11 0.24
12 0.24
13 0.25
14 0.23
15 0.24
16 0.17
17 0.17
18 0.16
19 0.17
20 0.16
21 0.15
22 0.16
23 0.16
24 0.22
25 0.23
26 0.24
27 0.22
28 0.27
29 0.28
30 0.28
31 0.3
32 0.25
33 0.23
34 0.22
35 0.24
36 0.22
37 0.23
38 0.22
39 0.18
40 0.17
41 0.18
42 0.19
43 0.16
44 0.21
45 0.2
46 0.24
47 0.28
48 0.31
49 0.31
50 0.32
51 0.33
52 0.24
53 0.27
54 0.25
55 0.24
56 0.2
57 0.19
58 0.16
59 0.16
60 0.17
61 0.13
62 0.15
63 0.12
64 0.14
65 0.14
66 0.15
67 0.17
68 0.2
69 0.24
70 0.23
71 0.25
72 0.24
73 0.26
74 0.31
75 0.3
76 0.27
77 0.24
78 0.28
79 0.26
80 0.26
81 0.27
82 0.23
83 0.24
84 0.25
85 0.27
86 0.24
87 0.31
88 0.39
89 0.37
90 0.36
91 0.33
92 0.36
93 0.34
94 0.35
95 0.36
96 0.28
97 0.28
98 0.27
99 0.28
100 0.27
101 0.25
102 0.24
103 0.21
104 0.22
105 0.23
106 0.24
107 0.24
108 0.21
109 0.21
110 0.19
111 0.13
112 0.1
113 0.08
114 0.06
115 0.06
116 0.05
117 0.05
118 0.04
119 0.04
120 0.04
121 0.05
122 0.07
123 0.07
124 0.1
125 0.12
126 0.15
127 0.15
128 0.18
129 0.2
130 0.2
131 0.23
132 0.22
133 0.22
134 0.26
135 0.32
136 0.32
137 0.37
138 0.36
139 0.34
140 0.38
141 0.37
142 0.32
143 0.33
144 0.32
145 0.27
146 0.35
147 0.36
148 0.36
149 0.45
150 0.51
151 0.49
152 0.56
153 0.62
154 0.59
155 0.67
156 0.7
157 0.71
158 0.73
159 0.77
160 0.77
161 0.71
162 0.67
163 0.6
164 0.52
165 0.49
166 0.4
167 0.32
168 0.23
169 0.21
170 0.2
171 0.18
172 0.16
173 0.1
174 0.08
175 0.09
176 0.08
177 0.12
178 0.13
179 0.13
180 0.13
181 0.13
182 0.13
183 0.12
184 0.11
185 0.07
186 0.07
187 0.06
188 0.07
189 0.06
190 0.07
191 0.07
192 0.09
193 0.09
194 0.09
195 0.09
196 0.12
197 0.13
198 0.13
199 0.12
200 0.12
201 0.13
202 0.13
203 0.15
204 0.14
205 0.17
206 0.18
207 0.18
208 0.18
209 0.17
210 0.17
211 0.14
212 0.13
213 0.09
214 0.1
215 0.13
216 0.13
217 0.12
218 0.14
219 0.14
220 0.16
221 0.21
222 0.25
223 0.27
224 0.34
225 0.4
226 0.49
227 0.6
228 0.65
229 0.7
230 0.76
231 0.81
232 0.85
233 0.87
234 0.87
235 0.88
236 0.91
237 0.91
238 0.9
239 0.85
240 0.82
241 0.79
242 0.69
243 0.64
244 0.58
245 0.49
246 0.48
247 0.5
248 0.48
249 0.5
250 0.5
251 0.46
252 0.45
253 0.48
254 0.49
255 0.52