Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067Q9C6

Protein Details
Accession A0A067Q9C6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTKKRRNNGRNKKGRGHVGFVBasic
95-114RAPPPRVRWKDGKKVNPAVTHydrophilic
NLS Segment(s)
PositionSequence
3-15KKRRNNGRNKKGR
92-108RRNRAPPPRVRWKDGKK
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTKKRRNNGRNKKGRGHVGFVRCSNCSRCVAKDKAIKRFTVRNMVESAAVRDISDASFYPEYVVPKLYLKIAYCVSCAIHSHVVRVRSTEGRRNRAPPPRVRWKDGKKVNPAVTAAEDAKAAART
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.8
3 0.76
4 0.73
5 0.69
6 0.66
7 0.61
8 0.56
9 0.47
10 0.46
11 0.42
12 0.38
13 0.36
14 0.33
15 0.35
16 0.4
17 0.42
18 0.47
19 0.51
20 0.54
21 0.59
22 0.59
23 0.56
24 0.52
25 0.56
26 0.52
27 0.54
28 0.48
29 0.4
30 0.39
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.12
38 0.1
39 0.1
40 0.08
41 0.08
42 0.07
43 0.09
44 0.09
45 0.09
46 0.1
47 0.11
48 0.12
49 0.12
50 0.12
51 0.1
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.13
58 0.14
59 0.14
60 0.14
61 0.14
62 0.13
63 0.12
64 0.13
65 0.13
66 0.18
67 0.17
68 0.21
69 0.23
70 0.25
71 0.25
72 0.25
73 0.26
74 0.27
75 0.31
76 0.36
77 0.42
78 0.47
79 0.51
80 0.54
81 0.59
82 0.62
83 0.66
84 0.67
85 0.68
86 0.72
87 0.73
88 0.75
89 0.77
90 0.77
91 0.79
92 0.8
93 0.79
94 0.78
95 0.81
96 0.79
97 0.73
98 0.65
99 0.57
100 0.49
101 0.44
102 0.35
103 0.27
104 0.22
105 0.17