Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067P6L3

Protein Details
Accession A0A067P6L3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-89NARPRSCSSPRPPRRDRPKRSPRDNQGCQRPGCHydrophilic
NLS Segment(s)
PositionSequence
67-77RPPRRDRPKRS
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MGYINYQSGRPAPYLQPQPQQPYSYPEGYSLLYQTPLPNEPSEAQPPSAPPPQPVENARPRSCSSPRPPRRDRPKRSPRDNQGCQRPGCSFVGQHTHADQSNLSRFYNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.47
4 0.51
5 0.56
6 0.57
7 0.56
8 0.49
9 0.46
10 0.45
11 0.41
12 0.36
13 0.29
14 0.27
15 0.25
16 0.24
17 0.19
18 0.14
19 0.12
20 0.12
21 0.12
22 0.12
23 0.13
24 0.15
25 0.14
26 0.15
27 0.15
28 0.18
29 0.21
30 0.2
31 0.19
32 0.18
33 0.19
34 0.21
35 0.24
36 0.21
37 0.19
38 0.22
39 0.24
40 0.26
41 0.27
42 0.29
43 0.34
44 0.4
45 0.4
46 0.39
47 0.38
48 0.41
49 0.42
50 0.44
51 0.45
52 0.5
53 0.58
54 0.64
55 0.71
56 0.75
57 0.83
58 0.86
59 0.86
60 0.86
61 0.88
62 0.89
63 0.91
64 0.91
65 0.9
66 0.9
67 0.9
68 0.88
69 0.87
70 0.84
71 0.75
72 0.68
73 0.58
74 0.51
75 0.45
76 0.38
77 0.29
78 0.27
79 0.33
80 0.32
81 0.33
82 0.3
83 0.31
84 0.3
85 0.3
86 0.27
87 0.26
88 0.31
89 0.31