Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PZZ0

Protein Details
Accession A0A067PZZ0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-89VLKNKALRFFKKSPRWKRLKPLDPTFSPHydrophilic
NLS Segment(s)
PositionSequence
64-81KNKALRFFKKSPRWKRLK
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
Pfam View protein in Pfam  
PF00075  RNase_H  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences LQLVIRWVPGHEGISGNERADVEAKEAARGNTSTSHIDLLPPILKSTLPRSKSTRVQHFRGVLKNKALRFFKKSPRWKRLKPLDPTFSPEKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.19
4 0.18
5 0.17
6 0.17
7 0.17
8 0.16
9 0.13
10 0.15
11 0.15
12 0.16
13 0.18
14 0.17
15 0.17
16 0.17
17 0.16
18 0.15
19 0.17
20 0.16
21 0.16
22 0.16
23 0.14
24 0.14
25 0.13
26 0.12
27 0.12
28 0.1
29 0.1
30 0.09
31 0.09
32 0.1
33 0.18
34 0.23
35 0.24
36 0.28
37 0.33
38 0.38
39 0.46
40 0.53
41 0.57
42 0.56
43 0.57
44 0.59
45 0.6
46 0.59
47 0.59
48 0.56
49 0.49
50 0.51
51 0.52
52 0.49
53 0.51
54 0.52
55 0.49
56 0.52
57 0.56
58 0.59
59 0.64
60 0.73
61 0.76
62 0.81
63 0.86
64 0.86
65 0.88
66 0.89
67 0.88
68 0.87
69 0.87
70 0.85
71 0.78
72 0.76