Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PF88

Protein Details
Accession A0A067PF88    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
100-128CLKWQTTADTKRKKSPNKPSSRRKPSGALHydrophilic
NLS Segment(s)
PositionSequence
110-126KRKKSPNKPSSRRKPSG
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 8, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MTGAMIIIRIHFVGSFSSHNRYCSTPLRYIINPTHVSLQGFPLEGNPEAVHELTQPSSLLCLLNVIPPYYKISILPSSLYCCGIIHDTLRRSWSRSARFCLKWQTTADTKRKKSPNKPSSRRKPSGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.15
3 0.17
4 0.24
5 0.25
6 0.27
7 0.29
8 0.3
9 0.32
10 0.36
11 0.39
12 0.38
13 0.39
14 0.43
15 0.41
16 0.45
17 0.44
18 0.43
19 0.39
20 0.34
21 0.35
22 0.31
23 0.31
24 0.25
25 0.23
26 0.17
27 0.16
28 0.14
29 0.11
30 0.12
31 0.11
32 0.12
33 0.1
34 0.09
35 0.1
36 0.1
37 0.09
38 0.07
39 0.08
40 0.07
41 0.08
42 0.07
43 0.06
44 0.07
45 0.07
46 0.06
47 0.05
48 0.06
49 0.05
50 0.08
51 0.08
52 0.08
53 0.08
54 0.09
55 0.11
56 0.11
57 0.11
58 0.1
59 0.13
60 0.14
61 0.15
62 0.15
63 0.13
64 0.16
65 0.16
66 0.16
67 0.13
68 0.11
69 0.12
70 0.12
71 0.12
72 0.11
73 0.16
74 0.17
75 0.18
76 0.22
77 0.22
78 0.24
79 0.31
80 0.37
81 0.41
82 0.46
83 0.52
84 0.57
85 0.59
86 0.61
87 0.64
88 0.59
89 0.55
90 0.52
91 0.5
92 0.5
93 0.56
94 0.61
95 0.61
96 0.63
97 0.67
98 0.74
99 0.79
100 0.81
101 0.83
102 0.84
103 0.85
104 0.9
105 0.92
106 0.94
107 0.94
108 0.9