Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067QM36

Protein Details
Accession A0A067QM36   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MVVKVPIVKKRTKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-52KKRTKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) mito 13.5, mito_nucl 12.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVVKVPIVKKRTKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGLKKFLVNNVREVDLLLMHNKSFAAEIAHGVSSRNRTVILERAKVLGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.9
4 0.91
5 0.91
6 0.91
7 0.89
8 0.88
9 0.86
10 0.79
11 0.7
12 0.69
13 0.67
14 0.65
15 0.68
16 0.69
17 0.69
18 0.67
19 0.67
20 0.67
21 0.69
22 0.69
23 0.69
24 0.69
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.64
34 0.64
35 0.63
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.47
49 0.47
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.48
57 0.4
58 0.37
59 0.34
60 0.34
61 0.24
62 0.26
63 0.26
64 0.27
65 0.27
66 0.26
67 0.19
68 0.13
69 0.13
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.07
78 0.08
79 0.08
80 0.09
81 0.1
82 0.11
83 0.11
84 0.11
85 0.14
86 0.15
87 0.16
88 0.16
89 0.15
90 0.16
91 0.19
92 0.27
93 0.31
94 0.31
95 0.31
96 0.32
97 0.32
98 0.31
99 0.29
100 0.26
101 0.2
102 0.18
103 0.21
104 0.25
105 0.26
106 0.27
107 0.31
108 0.28