FuNGI

A0A067Q174

Protein Details

Accession

A0A067Q174

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
442-468	FDIQGEKKGKGKKDKSKEEAEKDGPRN	Basic

NLS Segment(s)

Position	Sequence
448-461	KKGKGKKDKSKEEA

Subcellular Location(s)

mito 11.5, extr 11, cyto_mito 7.5, cyto 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR009011 Man6P_isomerase_rcpt-bd_dom_sf IPR044865 MRH_dom IPR045149 OS-9-like IPR012913 OS9-like_dom
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane GO:0030246 F:carbohydrate binding GO:0030968 P:endoplasmic reticulum unfolded protein response GO:0030433 P:ubiquitin-dependent ERAD pathway
Pfam	View protein in Pfam PF07915 PRKCSH
PROSITE	View protein in PROSITE PS51914 MRH

Amino Acid Sequences

MPPFRGLVPPFLLAYLALQVTARLLHSVPEDPFASPKYRITFLNGLPVLHDTAQKWLERGLTGGELEFLEQPWRDEAQHREAAWKEIGSGDEQVPLSTSEPSSQITSHSLELMKIGPRISYLCLIPPPLDTPTPPVEEPQQDPTPVHSWSLLQALSGTCLYHRQGWFTYSYCHNSHVRQFREMAHQHPHPPGGYKPEEDPEVSNPKFLVQLYSTYRYQWEAYTLGRAPPIPEPGAELTTAEEAVLAANLELAKSAGSSYLVQRWGDGSVCDKTGRKREIEVQFHCSMTMTDTILFVKETKTCHYVMVIHTPRLCGEPGFKSPLEQPEEAFIRCREVVDSLSGADPTLPESDFPLQVTKSTKPISPPPPLPVDGADRLKQALGSDVLKKALEALIGTDKLTGDEFLVEHYDDGEVVIEFIDADQLMGGGGHDQLAEALRAAGFDIQGEKKGKGKKDKSKEEAEKDGPRNHID

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.15
3	0.11
4	0.1
5	0.09
6	0.09
7	0.1
8	0.11
9	0.1
10	0.09
11	0.09
12	0.11
13	0.14
14	0.19
15	0.19
16	0.22
17	0.23
18	0.22
19	0.25
20	0.25
21	0.27
22	0.25
23	0.29
24	0.3
25	0.31
26	0.32
27	0.36
28	0.4
29	0.37
30	0.45
31	0.41
32	0.36
33	0.34
34	0.35
35	0.3
36	0.24
37	0.26
38	0.16
39	0.22
40	0.26
41	0.25
42	0.24
43	0.24
44	0.25
45	0.22
46	0.22
47	0.18
48	0.16
49	0.16
50	0.15
51	0.14
52	0.11
53	0.12
54	0.12
55	0.1
56	0.12
57	0.12
58	0.13
59	0.15
60	0.16
61	0.17
62	0.22
63	0.28
64	0.32
65	0.38
66	0.37
67	0.4
68	0.39
69	0.42
70	0.38
71	0.32
72	0.25
73	0.2
74	0.21
75	0.17
76	0.18
77	0.14
78	0.16
79	0.16
80	0.15
81	0.15
82	0.15
83	0.14
84	0.13
85	0.13
86	0.11
87	0.13
88	0.14
89	0.15
90	0.14
91	0.15
92	0.16
93	0.18
94	0.17
95	0.18
96	0.17
97	0.15
98	0.16
99	0.17
100	0.17
101	0.16
102	0.16
103	0.13
104	0.14
105	0.16
106	0.16
107	0.16
108	0.14
109	0.15
110	0.16
111	0.17
112	0.17
113	0.16
114	0.16
115	0.17
116	0.17
117	0.15
118	0.18
119	0.21
120	0.24
121	0.23
122	0.22
123	0.24
124	0.27
125	0.29
126	0.31
127	0.29
128	0.27
129	0.27
130	0.3
131	0.28
132	0.25
133	0.23
134	0.17
135	0.15
136	0.16
137	0.18
138	0.13
139	0.1
140	0.11
141	0.1
142	0.11
143	0.11
144	0.09
145	0.07
146	0.1
147	0.11
148	0.16
149	0.16
150	0.18
151	0.19
152	0.2
153	0.23
154	0.21
155	0.23
156	0.22
157	0.26
158	0.24
159	0.26
160	0.28
161	0.28
162	0.35
163	0.41
164	0.39
165	0.37
166	0.38
167	0.37
168	0.44
169	0.43
170	0.39
171	0.37
172	0.37
173	0.38
174	0.38
175	0.37
176	0.28
177	0.28
178	0.25
179	0.26
180	0.25
181	0.23
182	0.23
183	0.23
184	0.24
185	0.23
186	0.22
187	0.2
188	0.26
189	0.25
190	0.24
191	0.21
192	0.21
193	0.21
194	0.19
195	0.17
196	0.1
197	0.15
198	0.18
199	0.22
200	0.22
201	0.21
202	0.22
203	0.21
204	0.21
205	0.16
206	0.14
207	0.12
208	0.12
209	0.15
210	0.15
211	0.14
212	0.14
213	0.13
214	0.13
215	0.13
216	0.15
217	0.12
218	0.11
219	0.13
220	0.13
221	0.14
222	0.12
223	0.1
224	0.08
225	0.08
226	0.08
227	0.06
228	0.05
229	0.04
230	0.04
231	0.04
232	0.03
233	0.02
234	0.03
235	0.03
236	0.03
237	0.03
238	0.03
239	0.03
240	0.03
241	0.03
242	0.03
243	0.05
244	0.06
245	0.07
246	0.11
247	0.13
248	0.13
249	0.13
250	0.13
251	0.13
252	0.13
253	0.12
254	0.11
255	0.1
256	0.11
257	0.13
258	0.14
259	0.19
260	0.27
261	0.3
262	0.28
263	0.3
264	0.38
265	0.46
266	0.52
267	0.5
268	0.48
269	0.46
270	0.45
271	0.42
272	0.33
273	0.24
274	0.17
275	0.16
276	0.1
277	0.08
278	0.09
279	0.09
280	0.09
281	0.09
282	0.08
283	0.08
284	0.1
285	0.12
286	0.14
287	0.17
288	0.17
289	0.17
290	0.18
291	0.2
292	0.19
293	0.28
294	0.28
295	0.28
296	0.28
297	0.28
298	0.27
299	0.26
300	0.24
301	0.14
302	0.16
303	0.17
304	0.2
305	0.24
306	0.23
307	0.23
308	0.27
309	0.33
310	0.34
311	0.3
312	0.27
313	0.28
314	0.3
315	0.29
316	0.28
317	0.21
318	0.2
319	0.2
320	0.2
321	0.16
322	0.15
323	0.16
324	0.15
325	0.15
326	0.12
327	0.12
328	0.12
329	0.11
330	0.09
331	0.08
332	0.08
333	0.09
334	0.08
335	0.07
336	0.11
337	0.13
338	0.14
339	0.15
340	0.16
341	0.15
342	0.18
343	0.22
344	0.21
345	0.25
346	0.26
347	0.27
348	0.29
349	0.38
350	0.43
351	0.47
352	0.48
353	0.46
354	0.49
355	0.49
356	0.45
357	0.39
358	0.37
359	0.35
360	0.36
361	0.33
362	0.29
363	0.28
364	0.27
365	0.25
366	0.19
367	0.16
368	0.15
369	0.16
370	0.19
371	0.2
372	0.22
373	0.21
374	0.2
375	0.18
376	0.16
377	0.14
378	0.1
379	0.12
380	0.15
381	0.16
382	0.16
383	0.16
384	0.15
385	0.15
386	0.16
387	0.13
388	0.08
389	0.09
390	0.09
391	0.09
392	0.11
393	0.11
394	0.1
395	0.1
396	0.09
397	0.08
398	0.08
399	0.08
400	0.06
401	0.06
402	0.06
403	0.05
404	0.05
405	0.05
406	0.06
407	0.05
408	0.05
409	0.04
410	0.04
411	0.04
412	0.04
413	0.04
414	0.04
415	0.05
416	0.05
417	0.05
418	0.05
419	0.06
420	0.07
421	0.07
422	0.07
423	0.08
424	0.07
425	0.07
426	0.08
427	0.09
428	0.08
429	0.08
430	0.13
431	0.14
432	0.21
433	0.23
434	0.24
435	0.3
436	0.38
437	0.46
438	0.52
439	0.61
440	0.66
441	0.74
442	0.83
443	0.84
444	0.88
445	0.89
446	0.86
447	0.85
448	0.82
449	0.81
450	0.77
451	0.76

A0A067Q174

3D AlphaFold-predicted Structure Viewer