Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067QI50

Protein Details
Accession A0A067QI50    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MNQAMRRKRPEKQKKIKSPLLENNPQRHydrophilic
34-53IFVMKPKKPNSAKRKVARVKHydrophilic
NLS Segment(s)
PositionSequence
6-18RRKRPEKQKKIKS
38-51KPKKPNSAKRKVAR
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MNQAMRRKRPEKQKKIKSPLLENNPQRKGVCSMIFVMKPKKPNSAKRKVARVKLSTGKTVMAYISGEGHNLQEHSVVLVRGGRAQDLPGVRYKIVRGCLDFGGVVGRAQARSRYGAKKPKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.92
3 0.91
4 0.87
5 0.86
6 0.85
7 0.83
8 0.81
9 0.79
10 0.79
11 0.75
12 0.7
13 0.61
14 0.53
15 0.48
16 0.44
17 0.37
18 0.28
19 0.28
20 0.29
21 0.3
22 0.32
23 0.33
24 0.31
25 0.35
26 0.36
27 0.43
28 0.46
29 0.55
30 0.61
31 0.66
32 0.72
33 0.73
34 0.81
35 0.79
36 0.79
37 0.77
38 0.69
39 0.65
40 0.63
41 0.58
42 0.5
43 0.43
44 0.36
45 0.28
46 0.25
47 0.18
48 0.11
49 0.09
50 0.07
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08
67 0.1
68 0.1
69 0.1
70 0.09
71 0.1
72 0.13
73 0.13
74 0.15
75 0.18
76 0.2
77 0.19
78 0.2
79 0.22
80 0.23
81 0.27
82 0.29
83 0.26
84 0.27
85 0.27
86 0.27
87 0.25
88 0.2
89 0.17
90 0.14
91 0.11
92 0.1
93 0.11
94 0.11
95 0.13
96 0.17
97 0.17
98 0.22
99 0.29
100 0.35
101 0.43