Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067Q132

Protein Details
Accession A0A067Q132    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-49PSEAQGKTKAKKRYLRRKKERRKHKKAATSKGDKNVKVBasic
89-112GVDVHDERPKKRRKVDQSEDAKEABasic
NLS Segment(s)
PositionSequence
18-43KTKAKKRYLRRKKERRKHKKAATSKG
98-101KKRR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR000629  RNA-helicase_DEAD-box_CS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004386  F:helicase activity  
GO:0016787  F:hydrolase activity  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS00039  DEAD_ATP_HELICASE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
CDD cd17956  DEADc_DDX51  
cd18787  SF2_C_DEAD  
Amino Acid Sequences MTEIGEGRQSMPSEAQGKTKAKKRYLRRKKERRKHKKAATSKGDKNVKVAESSNVTDSEEEEEEQDSVVTDSPVVRFEGGEGSQKTSEGVDVHDERPKKRRKVDQSEDAKEATPHEHSPEPLTSEVTDRLKSPLPALPSFPLPIHPNAPSKRDLALQGLDPALVHADIVDSSTVLPIADGEEDESTGLTERTRKRLKDLGISELFAVQTALLPFLLPPDVTQRSLYLSYAPPRDVCVSAPTGSGKTLAYVLPIVDILSSRIVTRLRALVVLPTRDLVTQVRETFEAVSKGRGLKIGTATGQHSFTHEQTQLIADGSTRLQGGSSKVDILICTPGRLIDHLNGTPNFSLQHLRFLVIDEADRLLAQTFQGWLAQVLSATRTSHLQSLSAVDGVDRPHHPSPDALSPVSLHLSTEFPEFHTDLDEKKESSCQKLLFSATLTRDPGKIAALELRDPRYFIVKSGAEKADALDVVEKFTIPATLKEQMIVCDSAQKPLMLFYLVYTHNVTNALVFTKSAESTTRLVRLFEFFQSVRQPSEDQGEPRRVVIQSYSSDSPPSERKSLLERFKGKEIHILVASDLISRGIDISHVSHVVSYDVPVDMRKYVHRVGRTARAGRMGEAWTLVEEQEARYFKSMLKVADHLEKVKRLRVSEKDLAPLLPSYELALRQLKEAYSRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.36
4 0.43
5 0.49
6 0.55
7 0.59
8 0.64
9 0.71
10 0.77
11 0.8
12 0.84
13 0.88
14 0.91
15 0.93
16 0.95
17 0.97
18 0.97
19 0.97
20 0.97
21 0.96
22 0.96
23 0.95
24 0.94
25 0.94
26 0.94
27 0.92
28 0.89
29 0.88
30 0.87
31 0.76
32 0.71
33 0.66
34 0.57
35 0.5
36 0.44
37 0.39
38 0.35
39 0.36
40 0.34
41 0.28
42 0.27
43 0.23
44 0.23
45 0.22
46 0.18
47 0.16
48 0.15
49 0.15
50 0.14
51 0.14
52 0.13
53 0.09
54 0.09
55 0.09
56 0.08
57 0.08
58 0.09
59 0.1
60 0.12
61 0.12
62 0.11
63 0.1
64 0.11
65 0.15
66 0.15
67 0.22
68 0.22
69 0.25
70 0.25
71 0.25
72 0.25
73 0.2
74 0.21
75 0.14
76 0.15
77 0.17
78 0.21
79 0.23
80 0.28
81 0.32
82 0.34
83 0.44
84 0.52
85 0.54
86 0.6
87 0.68
88 0.74
89 0.81
90 0.87
91 0.87
92 0.88
93 0.84
94 0.78
95 0.68
96 0.58
97 0.48
98 0.4
99 0.32
100 0.26
101 0.21
102 0.23
103 0.24
104 0.24
105 0.27
106 0.28
107 0.28
108 0.25
109 0.25
110 0.21
111 0.22
112 0.26
113 0.25
114 0.24
115 0.21
116 0.24
117 0.26
118 0.26
119 0.26
120 0.24
121 0.26
122 0.27
123 0.29
124 0.27
125 0.26
126 0.27
127 0.24
128 0.25
129 0.23
130 0.24
131 0.24
132 0.26
133 0.33
134 0.34
135 0.38
136 0.36
137 0.35
138 0.34
139 0.33
140 0.31
141 0.27
142 0.26
143 0.23
144 0.23
145 0.21
146 0.19
147 0.16
148 0.14
149 0.1
150 0.08
151 0.06
152 0.04
153 0.04
154 0.04
155 0.05
156 0.05
157 0.04
158 0.05
159 0.05
160 0.05
161 0.05
162 0.04
163 0.04
164 0.05
165 0.05
166 0.05
167 0.06
168 0.06
169 0.06
170 0.07
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.14
177 0.18
178 0.27
179 0.35
180 0.36
181 0.41
182 0.48
183 0.51
184 0.53
185 0.52
186 0.51
187 0.46
188 0.45
189 0.39
190 0.33
191 0.28
192 0.18
193 0.16
194 0.07
195 0.07
196 0.06
197 0.07
198 0.05
199 0.06
200 0.05
201 0.06
202 0.07
203 0.05
204 0.06
205 0.12
206 0.15
207 0.16
208 0.17
209 0.16
210 0.19
211 0.2
212 0.2
213 0.16
214 0.17
215 0.21
216 0.23
217 0.23
218 0.2
219 0.22
220 0.24
221 0.21
222 0.19
223 0.17
224 0.17
225 0.17
226 0.17
227 0.16
228 0.15
229 0.14
230 0.14
231 0.11
232 0.09
233 0.1
234 0.09
235 0.08
236 0.08
237 0.08
238 0.07
239 0.07
240 0.06
241 0.05
242 0.05
243 0.05
244 0.06
245 0.06
246 0.06
247 0.09
248 0.09
249 0.1
250 0.11
251 0.12
252 0.12
253 0.12
254 0.12
255 0.15
256 0.17
257 0.17
258 0.16
259 0.14
260 0.15
261 0.14
262 0.15
263 0.12
264 0.12
265 0.15
266 0.15
267 0.16
268 0.16
269 0.16
270 0.16
271 0.17
272 0.16
273 0.13
274 0.13
275 0.14
276 0.15
277 0.15
278 0.16
279 0.14
280 0.13
281 0.15
282 0.15
283 0.14
284 0.15
285 0.15
286 0.15
287 0.16
288 0.13
289 0.14
290 0.15
291 0.15
292 0.18
293 0.17
294 0.16
295 0.15
296 0.15
297 0.13
298 0.11
299 0.11
300 0.06
301 0.06
302 0.06
303 0.07
304 0.06
305 0.05
306 0.05
307 0.07
308 0.08
309 0.1
310 0.1
311 0.09
312 0.1
313 0.1
314 0.1
315 0.09
316 0.12
317 0.1
318 0.1
319 0.09
320 0.1
321 0.1
322 0.11
323 0.11
324 0.08
325 0.11
326 0.12
327 0.15
328 0.15
329 0.16
330 0.15
331 0.14
332 0.12
333 0.1
334 0.14
335 0.11
336 0.16
337 0.15
338 0.16
339 0.16
340 0.16
341 0.16
342 0.13
343 0.13
344 0.08
345 0.08
346 0.07
347 0.07
348 0.06
349 0.05
350 0.05
351 0.04
352 0.05
353 0.05
354 0.05
355 0.05
356 0.05
357 0.05
358 0.05
359 0.05
360 0.05
361 0.05
362 0.06
363 0.06
364 0.07
365 0.07
366 0.08
367 0.09
368 0.12
369 0.12
370 0.11
371 0.11
372 0.12
373 0.12
374 0.11
375 0.1
376 0.07
377 0.09
378 0.09
379 0.11
380 0.1
381 0.15
382 0.16
383 0.17
384 0.18
385 0.17
386 0.2
387 0.23
388 0.25
389 0.19
390 0.18
391 0.18
392 0.18
393 0.18
394 0.15
395 0.09
396 0.08
397 0.08
398 0.09
399 0.1
400 0.09
401 0.09
402 0.12
403 0.12
404 0.11
405 0.13
406 0.13
407 0.13
408 0.17
409 0.18
410 0.16
411 0.16
412 0.22
413 0.22
414 0.26
415 0.29
416 0.26
417 0.26
418 0.28
419 0.29
420 0.23
421 0.23
422 0.23
423 0.21
424 0.22
425 0.23
426 0.21
427 0.2
428 0.2
429 0.19
430 0.15
431 0.13
432 0.11
433 0.12
434 0.13
435 0.16
436 0.19
437 0.22
438 0.21
439 0.21
440 0.21
441 0.23
442 0.22
443 0.19
444 0.22
445 0.21
446 0.23
447 0.29
448 0.29
449 0.24
450 0.24
451 0.23
452 0.19
453 0.16
454 0.15
455 0.12
456 0.11
457 0.12
458 0.12
459 0.11
460 0.09
461 0.09
462 0.12
463 0.09
464 0.11
465 0.14
466 0.18
467 0.18
468 0.19
469 0.2
470 0.18
471 0.2
472 0.19
473 0.15
474 0.19
475 0.2
476 0.21
477 0.21
478 0.2
479 0.18
480 0.18
481 0.19
482 0.11
483 0.11
484 0.09
485 0.13
486 0.13
487 0.15
488 0.16
489 0.15
490 0.16
491 0.16
492 0.16
493 0.11
494 0.12
495 0.11
496 0.09
497 0.09
498 0.09
499 0.11
500 0.11
501 0.11
502 0.12
503 0.14
504 0.16
505 0.2
506 0.24
507 0.23
508 0.23
509 0.24
510 0.26
511 0.25
512 0.24
513 0.25
514 0.2
515 0.23
516 0.28
517 0.28
518 0.26
519 0.26
520 0.26
521 0.23
522 0.28
523 0.28
524 0.28
525 0.33
526 0.38
527 0.37
528 0.36
529 0.38
530 0.33
531 0.3
532 0.28
533 0.26
534 0.22
535 0.27
536 0.28
537 0.25
538 0.26
539 0.25
540 0.27
541 0.29
542 0.32
543 0.3
544 0.28
545 0.3
546 0.37
547 0.46
548 0.5
549 0.52
550 0.54
551 0.55
552 0.62
553 0.63
554 0.56
555 0.55
556 0.48
557 0.43
558 0.37
559 0.33
560 0.26
561 0.24
562 0.24
563 0.16
564 0.14
565 0.1
566 0.08
567 0.08
568 0.08
569 0.06
570 0.06
571 0.07
572 0.09
573 0.11
574 0.12
575 0.12
576 0.12
577 0.12
578 0.13
579 0.12
580 0.11
581 0.1
582 0.1
583 0.1
584 0.11
585 0.13
586 0.13
587 0.15
588 0.19
589 0.23
590 0.29
591 0.35
592 0.38
593 0.42
594 0.46
595 0.54
596 0.58
597 0.57
598 0.55
599 0.55
600 0.52
601 0.47
602 0.45
603 0.37
604 0.29
605 0.26
606 0.23
607 0.16
608 0.16
609 0.15
610 0.12
611 0.11
612 0.12
613 0.18
614 0.19
615 0.2
616 0.21
617 0.23
618 0.23
619 0.3
620 0.33
621 0.28
622 0.31
623 0.32
624 0.34
625 0.41
626 0.43
627 0.4
628 0.42
629 0.46
630 0.46
631 0.5
632 0.5
633 0.46
634 0.52
635 0.55
636 0.59
637 0.6
638 0.6
639 0.59
640 0.56
641 0.52
642 0.45
643 0.38
644 0.3
645 0.23
646 0.19
647 0.16
648 0.17
649 0.17
650 0.2
651 0.25
652 0.24
653 0.25
654 0.28
655 0.27