Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PLN3

Protein Details
Accession A0A067PLN3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-30HLPPRPLPSLPKKPRYPCPHLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 11.833, cyto 4.5, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences MKRYTYNSHLPPRPLPSLPKKPRYPCPHLSTPQISEFLIPLYDRGWAVNVVKDRGKIVGRNLKKDFEFGQGKEGWKAIRRFVGVLMDLAESEKVCFFSLGLGWELMLLGGVASSDCQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.56
4 0.62
5 0.66
6 0.7
7 0.73
8 0.75
9 0.82
10 0.82
11 0.8
12 0.78
13 0.76
14 0.76
15 0.71
16 0.71
17 0.65
18 0.59
19 0.53
20 0.46
21 0.37
22 0.28
23 0.25
24 0.18
25 0.14
26 0.1
27 0.08
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.09
35 0.12
36 0.13
37 0.14
38 0.16
39 0.16
40 0.15
41 0.17
42 0.18
43 0.16
44 0.21
45 0.28
46 0.3
47 0.37
48 0.38
49 0.38
50 0.37
51 0.37
52 0.32
53 0.31
54 0.32
55 0.25
56 0.28
57 0.27
58 0.28
59 0.27
60 0.26
61 0.2
62 0.22
63 0.24
64 0.22
65 0.24
66 0.24
67 0.24
68 0.24
69 0.25
70 0.19
71 0.18
72 0.16
73 0.12
74 0.11
75 0.11
76 0.1
77 0.07
78 0.07
79 0.08
80 0.07
81 0.08
82 0.08
83 0.07
84 0.08
85 0.1
86 0.11
87 0.11
88 0.1
89 0.1
90 0.09
91 0.09
92 0.08
93 0.06
94 0.04
95 0.03
96 0.03
97 0.03
98 0.03