Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QT13

Protein Details
Accession B6QT13    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-70APKPASSAKDQEKKRKREDSDNTAQNGKKQKGWNKDKKFNRNNKDKKKDDKKPSNKTAQQPDREEHydrophilic
NLS Segment(s)
PositionSequence
17-24EKKRKRED
29-59AQNGKKQKGWNKDKKFNRNNKDKKKDDKKPS
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MAETNAPKPASSAKDQEKKRKREDSDNTAQNGKKQKGWNKDKKFNRNNKDKKKDDKKPSNKTAQQPDREEAVDESISKMNEQILADHFMQKAKAHNKDLTAVELSDMCVPAHAFKDTTSFEQERKLAQLPAYLKAYSPEKGARLANAPEEKGTPHTLVISSAGLRAADLVRALRSFQNKDAAVAKLFAKHIKIEEAKQFLERSRVSIGVGTPQRIIDLLESGMFLLFNRRMNQLTLHQGTLKTEKLERIVIDGSHIDQKKRGIFDMKEVYAPLLKLLTREEFKGRYGSKDKDLKILVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.63
3 0.72
4 0.75
5 0.79
6 0.84
7 0.85
8 0.82
9 0.84
10 0.85
11 0.84
12 0.84
13 0.82
14 0.75
15 0.72
16 0.66
17 0.61
18 0.61
19 0.54
20 0.5
21 0.52
22 0.57
23 0.61
24 0.71
25 0.76
26 0.77
27 0.84
28 0.88
29 0.9
30 0.92
31 0.92
32 0.91
33 0.92
34 0.92
35 0.93
36 0.93
37 0.91
38 0.92
39 0.92
40 0.92
41 0.92
42 0.92
43 0.92
44 0.92
45 0.92
46 0.92
47 0.88
48 0.87
49 0.87
50 0.85
51 0.82
52 0.76
53 0.69
54 0.62
55 0.55
56 0.47
57 0.37
58 0.3
59 0.23
60 0.18
61 0.17
62 0.16
63 0.16
64 0.14
65 0.14
66 0.12
67 0.14
68 0.14
69 0.13
70 0.13
71 0.17
72 0.17
73 0.2
74 0.19
75 0.17
76 0.18
77 0.18
78 0.24
79 0.28
80 0.33
81 0.35
82 0.37
83 0.38
84 0.41
85 0.41
86 0.36
87 0.29
88 0.22
89 0.18
90 0.15
91 0.15
92 0.11
93 0.11
94 0.08
95 0.07
96 0.07
97 0.08
98 0.09
99 0.09
100 0.08
101 0.08
102 0.12
103 0.14
104 0.16
105 0.2
106 0.2
107 0.2
108 0.24
109 0.24
110 0.21
111 0.23
112 0.23
113 0.19
114 0.17
115 0.21
116 0.19
117 0.21
118 0.22
119 0.19
120 0.17
121 0.18
122 0.2
123 0.16
124 0.16
125 0.15
126 0.14
127 0.17
128 0.17
129 0.16
130 0.17
131 0.17
132 0.19
133 0.19
134 0.18
135 0.16
136 0.16
137 0.15
138 0.15
139 0.16
140 0.12
141 0.1
142 0.1
143 0.1
144 0.1
145 0.1
146 0.09
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.08
160 0.1
161 0.15
162 0.17
163 0.19
164 0.25
165 0.24
166 0.26
167 0.27
168 0.25
169 0.21
170 0.21
171 0.19
172 0.16
173 0.17
174 0.17
175 0.15
176 0.15
177 0.16
178 0.2
179 0.22
180 0.23
181 0.28
182 0.29
183 0.29
184 0.3
185 0.31
186 0.26
187 0.3
188 0.26
189 0.23
190 0.22
191 0.21
192 0.19
193 0.2
194 0.19
195 0.2
196 0.22
197 0.21
198 0.19
199 0.19
200 0.18
201 0.17
202 0.17
203 0.1
204 0.09
205 0.08
206 0.08
207 0.08
208 0.07
209 0.07
210 0.07
211 0.06
212 0.09
213 0.12
214 0.15
215 0.17
216 0.2
217 0.21
218 0.23
219 0.26
220 0.26
221 0.33
222 0.31
223 0.31
224 0.31
225 0.3
226 0.32
227 0.33
228 0.3
229 0.24
230 0.24
231 0.25
232 0.26
233 0.29
234 0.26
235 0.25
236 0.25
237 0.22
238 0.22
239 0.2
240 0.2
241 0.25
242 0.27
243 0.24
244 0.25
245 0.3
246 0.33
247 0.35
248 0.37
249 0.37
250 0.36
251 0.44
252 0.5
253 0.46
254 0.42
255 0.39
256 0.37
257 0.32
258 0.3
259 0.22
260 0.17
261 0.15
262 0.15
263 0.19
264 0.24
265 0.24
266 0.27
267 0.32
268 0.32
269 0.34
270 0.41
271 0.39
272 0.41
273 0.46
274 0.49
275 0.52
276 0.59
277 0.58
278 0.58