Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067QC22

Protein Details
Accession A0A067QC22    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-40LLAVPKKKTSHSRKRMRSANKGLKDKHydrophilic
NLS Segment(s)
PositionSequence
20-36KKKTSHSRKRMRSANKG
Subcellular Location(s) mito 22.5, mito_nucl 13.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MPTLQSLLDLLPPFLLAVPKKKTSHSRKRMRSANKGLKDKMNLVHCPGCGTPKLAHHLCAFCYSKLTRGWKKEAREGVPLVDSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.12
4 0.19
5 0.25
6 0.31
7 0.33
8 0.39
9 0.48
10 0.55
11 0.64
12 0.67
13 0.73
14 0.76
15 0.84
16 0.87
17 0.86
18 0.85
19 0.85
20 0.84
21 0.82
22 0.78
23 0.72
24 0.66
25 0.59
26 0.52
27 0.46
28 0.4
29 0.33
30 0.3
31 0.3
32 0.25
33 0.25
34 0.23
35 0.2
36 0.16
37 0.18
38 0.16
39 0.18
40 0.25
41 0.23
42 0.26
43 0.27
44 0.28
45 0.26
46 0.3
47 0.29
48 0.23
49 0.27
50 0.24
51 0.26
52 0.31
53 0.4
54 0.41
55 0.46
56 0.55
57 0.58
58 0.63
59 0.68
60 0.7
61 0.64
62 0.63
63 0.58
64 0.51