Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067Q0Y0

Protein Details
Accession A0A067Q0Y0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
199-234KGKGKGKGKSRAKPGPKSARSKPKPKAPVARRREEABasic
NLS Segment(s)
PositionSequence
198-231SKGKGKGKGKSRAKPGPKSARSKPKPKAPVARRR
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046520  DUF6697  
Pfam View protein in Pfam  
PF20411  DUF6697  
Amino Acid Sequences MPQNLDPTTNAQATHPKQWRVLFPNDDMNPCLPSNPGEPGMVFANRFEILDGESWTVFRKVEKSKPVLWVMDGEYVFTQCEAPLSGEEFGRQSDVVKKSWGSHILGARRCQSYVEIHARVYLRLKYPGEEITKERLDKAVSEIRKTNKEQPAKVQSRDVINALTCGEEVINILVMQCVGYDYAFEAEMREKMDEFVPSKGKGKGKGKSRAKPGPKSARSKPKPKAPVARRREEASDSGDDDPDAMEVEEIVRERRRSGRFVANAGSVVDRDGAEEEEESDGDGEDDDYAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.46
4 0.5
5 0.54
6 0.61
7 0.57
8 0.62
9 0.56
10 0.52
11 0.58
12 0.55
13 0.53
14 0.46
15 0.41
16 0.36
17 0.31
18 0.28
19 0.19
20 0.19
21 0.19
22 0.21
23 0.21
24 0.19
25 0.19
26 0.2
27 0.22
28 0.21
29 0.19
30 0.15
31 0.16
32 0.15
33 0.15
34 0.13
35 0.11
36 0.11
37 0.12
38 0.13
39 0.12
40 0.11
41 0.12
42 0.13
43 0.14
44 0.13
45 0.13
46 0.19
47 0.24
48 0.32
49 0.41
50 0.44
51 0.48
52 0.54
53 0.56
54 0.5
55 0.43
56 0.38
57 0.32
58 0.32
59 0.27
60 0.21
61 0.18
62 0.17
63 0.16
64 0.14
65 0.12
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.1
72 0.1
73 0.1
74 0.11
75 0.11
76 0.1
77 0.1
78 0.09
79 0.09
80 0.16
81 0.18
82 0.19
83 0.2
84 0.21
85 0.22
86 0.26
87 0.28
88 0.22
89 0.24
90 0.28
91 0.33
92 0.36
93 0.37
94 0.37
95 0.34
96 0.33
97 0.29
98 0.26
99 0.22
100 0.25
101 0.29
102 0.26
103 0.25
104 0.29
105 0.28
106 0.27
107 0.27
108 0.23
109 0.18
110 0.22
111 0.22
112 0.2
113 0.21
114 0.25
115 0.25
116 0.25
117 0.25
118 0.26
119 0.28
120 0.27
121 0.25
122 0.22
123 0.19
124 0.18
125 0.2
126 0.21
127 0.19
128 0.21
129 0.25
130 0.27
131 0.32
132 0.35
133 0.39
134 0.4
135 0.45
136 0.44
137 0.48
138 0.55
139 0.55
140 0.53
141 0.47
142 0.42
143 0.39
144 0.38
145 0.31
146 0.21
147 0.16
148 0.15
149 0.13
150 0.1
151 0.07
152 0.06
153 0.05
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.04
169 0.05
170 0.05
171 0.05
172 0.06
173 0.07
174 0.08
175 0.1
176 0.1
177 0.09
178 0.1
179 0.12
180 0.14
181 0.14
182 0.17
183 0.2
184 0.21
185 0.24
186 0.29
187 0.31
188 0.36
189 0.43
190 0.45
191 0.52
192 0.61
193 0.67
194 0.69
195 0.75
196 0.76
197 0.78
198 0.8
199 0.81
200 0.81
201 0.8
202 0.8
203 0.8
204 0.82
205 0.81
206 0.82
207 0.81
208 0.8
209 0.8
210 0.81
211 0.82
212 0.81
213 0.84
214 0.82
215 0.83
216 0.77
217 0.71
218 0.67
219 0.6
220 0.52
221 0.47
222 0.41
223 0.35
224 0.32
225 0.29
226 0.24
227 0.2
228 0.17
229 0.12
230 0.09
231 0.07
232 0.05
233 0.05
234 0.06
235 0.07
236 0.08
237 0.12
238 0.16
239 0.17
240 0.21
241 0.3
242 0.34
243 0.37
244 0.43
245 0.49
246 0.48
247 0.51
248 0.52
249 0.45
250 0.41
251 0.38
252 0.32
253 0.22
254 0.19
255 0.16
256 0.12
257 0.11
258 0.11
259 0.11
260 0.11
261 0.12
262 0.12
263 0.12
264 0.12
265 0.12
266 0.1
267 0.09
268 0.08
269 0.08
270 0.07