Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PD62

Protein Details
Accession A0A067PD62    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-32PYCKPPIRVRAVRDHRDRRKPRWCHQNVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MLTPYCKPPIRVRAVRDHRDRRKPRWCHQNVLLVLPSSHPTVAIPLPFPPNPPTVGATLVPKHSPFSQSVARARLSGLCRTSNFVEFLLRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.79
4 0.8
5 0.8
6 0.84
7 0.87
8 0.86
9 0.87
10 0.86
11 0.85
12 0.86
13 0.81
14 0.77
15 0.75
16 0.74
17 0.64
18 0.58
19 0.5
20 0.38
21 0.33
22 0.26
23 0.22
24 0.13
25 0.12
26 0.08
27 0.07
28 0.09
29 0.1
30 0.09
31 0.08
32 0.09
33 0.13
34 0.13
35 0.15
36 0.15
37 0.15
38 0.16
39 0.17
40 0.17
41 0.14
42 0.16
43 0.15
44 0.16
45 0.17
46 0.17
47 0.17
48 0.16
49 0.18
50 0.17
51 0.19
52 0.17
53 0.21
54 0.25
55 0.3
56 0.34
57 0.35
58 0.34
59 0.32
60 0.32
61 0.33
62 0.3
63 0.3
64 0.29
65 0.3
66 0.3
67 0.35
68 0.38
69 0.35
70 0.33
71 0.28