Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PKS9

Protein Details
Accession A0A067PKS9   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
66-94LTTTCRRSSTHRRRSRPHTHPSPTHPRLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MPVDSSDLLFKVINLSPRIKPSTSNNEQPYQHITHQPVPTPPHPAHSSEQPSEISKRIFLRLLLLLTTTCRRSSTHRRRSRPHTHPSPTHPRLCLLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.27
4 0.33
5 0.38
6 0.34
7 0.35
8 0.38
9 0.45
10 0.48
11 0.53
12 0.52
13 0.54
14 0.54
15 0.52
16 0.49
17 0.43
18 0.39
19 0.36
20 0.35
21 0.36
22 0.37
23 0.36
24 0.35
25 0.36
26 0.34
27 0.36
28 0.32
29 0.3
30 0.3
31 0.31
32 0.29
33 0.31
34 0.35
35 0.29
36 0.3
37 0.26
38 0.27
39 0.25
40 0.25
41 0.19
42 0.17
43 0.18
44 0.18
45 0.18
46 0.17
47 0.18
48 0.17
49 0.17
50 0.14
51 0.13
52 0.11
53 0.13
54 0.16
55 0.14
56 0.13
57 0.14
58 0.16
59 0.24
60 0.35
61 0.44
62 0.52
63 0.61
64 0.7
65 0.78
66 0.86
67 0.89
68 0.87
69 0.86
70 0.86
71 0.85
72 0.84
73 0.84
74 0.85
75 0.81
76 0.78
77 0.69