Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PXA0

Protein Details
Accession A0A067PXA0   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-30PSTPSQEPAKRKHKPSVKADSNNPDGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.333, mito_nucl 8.833, cyto 5.5, mito 2.5, pero 2
Family & Domain DBs
Amino Acid Sequences MAVMPSTPSQEPAKRKHKPSVKADSNNPDGDNNPVEPQADNEEGRRLIMKWDDNEAKLSWSMIGAIGNDPVIKRGLFPPEGPNQHQNGGKMKTEHYWAVCVALFANHDDYKVAFNQAVHGIPKDKTVWCNKIKNRISKMTEITWKGNTILGETGAGITKAEQINMTDDNTFTDKWRNSQSDFDLGVLIPGTGGEDLTISDAMSGIDNQSFSESSEGHNDGEQSDLGQTDSDIEVPEVNKRTGLAIKPLSTPVMLSDASSETKIEFGAAVTKKLKKEGARASINPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.75
4 0.78
5 0.8
6 0.82
7 0.83
8 0.83
9 0.82
10 0.84
11 0.82
12 0.78
13 0.72
14 0.63
15 0.53
16 0.43
17 0.4
18 0.34
19 0.27
20 0.23
21 0.21
22 0.21
23 0.19
24 0.21
25 0.21
26 0.22
27 0.21
28 0.21
29 0.24
30 0.23
31 0.24
32 0.23
33 0.18
34 0.19
35 0.24
36 0.27
37 0.25
38 0.33
39 0.36
40 0.35
41 0.38
42 0.34
43 0.3
44 0.25
45 0.24
46 0.16
47 0.12
48 0.11
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.08
57 0.09
58 0.09
59 0.08
60 0.09
61 0.12
62 0.18
63 0.19
64 0.21
65 0.25
66 0.32
67 0.37
68 0.39
69 0.41
70 0.38
71 0.41
72 0.41
73 0.39
74 0.38
75 0.36
76 0.35
77 0.31
78 0.31
79 0.28
80 0.29
81 0.29
82 0.23
83 0.21
84 0.18
85 0.18
86 0.17
87 0.14
88 0.11
89 0.1
90 0.09
91 0.08
92 0.12
93 0.1
94 0.1
95 0.11
96 0.11
97 0.12
98 0.12
99 0.12
100 0.09
101 0.09
102 0.11
103 0.12
104 0.13
105 0.12
106 0.12
107 0.13
108 0.13
109 0.15
110 0.15
111 0.15
112 0.19
113 0.25
114 0.32
115 0.36
116 0.45
117 0.47
118 0.55
119 0.6
120 0.64
121 0.63
122 0.63
123 0.6
124 0.55
125 0.55
126 0.48
127 0.47
128 0.42
129 0.38
130 0.31
131 0.28
132 0.24
133 0.23
134 0.18
135 0.14
136 0.11
137 0.09
138 0.08
139 0.07
140 0.07
141 0.05
142 0.05
143 0.04
144 0.04
145 0.08
146 0.08
147 0.08
148 0.08
149 0.09
150 0.11
151 0.12
152 0.13
153 0.09
154 0.09
155 0.11
156 0.12
157 0.12
158 0.11
159 0.17
160 0.17
161 0.2
162 0.26
163 0.28
164 0.28
165 0.32
166 0.34
167 0.32
168 0.32
169 0.29
170 0.23
171 0.2
172 0.18
173 0.13
174 0.1
175 0.05
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.05
184 0.05
185 0.04
186 0.04
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.06
193 0.06
194 0.07
195 0.08
196 0.08
197 0.08
198 0.1
199 0.1
200 0.11
201 0.15
202 0.17
203 0.15
204 0.16
205 0.16
206 0.14
207 0.15
208 0.13
209 0.09
210 0.09
211 0.08
212 0.08
213 0.07
214 0.07
215 0.08
216 0.08
217 0.08
218 0.08
219 0.08
220 0.1
221 0.1
222 0.16
223 0.17
224 0.17
225 0.17
226 0.17
227 0.2
228 0.23
229 0.25
230 0.28
231 0.29
232 0.31
233 0.33
234 0.34
235 0.32
236 0.27
237 0.25
238 0.18
239 0.17
240 0.15
241 0.13
242 0.14
243 0.15
244 0.16
245 0.17
246 0.15
247 0.12
248 0.12
249 0.12
250 0.1
251 0.08
252 0.07
253 0.15
254 0.16
255 0.21
256 0.27
257 0.33
258 0.34
259 0.4
260 0.46
261 0.43
262 0.52
263 0.56
264 0.6
265 0.63