Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067P5A4

Protein Details
Accession A0A067P5A4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
93-113PGGKAEKVRLRKERREAIRESBasic
NLS Segment(s)
PositionSequence
96-107KAEKVRLRKERR
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSSSLLRVLRPSQTLRCRHIARGLASNVLASPAKSPKAKDVEPESLSSCTPNTLMPGLNWLKDQPPVLALPDSEYPPWLWTLLQKKVLPDDGPGGKAEKVRLRKERREAIRESNFLKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.6
4 0.58
5 0.57
6 0.59
7 0.56
8 0.51
9 0.51
10 0.47
11 0.4
12 0.36
13 0.33
14 0.25
15 0.21
16 0.18
17 0.11
18 0.12
19 0.14
20 0.18
21 0.2
22 0.21
23 0.26
24 0.33
25 0.33
26 0.36
27 0.39
28 0.42
29 0.41
30 0.42
31 0.37
32 0.31
33 0.3
34 0.25
35 0.19
36 0.12
37 0.11
38 0.09
39 0.08
40 0.08
41 0.09
42 0.08
43 0.14
44 0.14
45 0.14
46 0.14
47 0.14
48 0.14
49 0.15
50 0.16
51 0.09
52 0.1
53 0.1
54 0.11
55 0.11
56 0.09
57 0.1
58 0.11
59 0.12
60 0.11
61 0.12
62 0.11
63 0.11
64 0.11
65 0.09
66 0.08
67 0.13
68 0.2
69 0.24
70 0.31
71 0.31
72 0.32
73 0.35
74 0.38
75 0.33
76 0.28
77 0.29
78 0.25
79 0.25
80 0.24
81 0.23
82 0.21
83 0.23
84 0.26
85 0.28
86 0.34
87 0.42
88 0.52
89 0.59
90 0.67
91 0.75
92 0.8
93 0.82
94 0.81
95 0.78
96 0.78
97 0.77
98 0.73
99 0.67