Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QA58

Protein Details
Accession B6QA58    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-30LQQGPDRKRSWRERLHPSAWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
KEGG tmf:PMAA_072980  -  
Amino Acid Sequences MNETKQTQFSLQQGPDRKRSWRERLHPSAWLVSMVLNGGVDHLPPKANSSCLESLLPLRSIGQSVGSRKADKLNWRVPGHVFPSPFALPSSGTPVLPGGPVYKCPPSLPSSPISTSLPILPKAAPAPPFSLLASPPTSFHLSPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.56
4 0.58
5 0.59
6 0.66
7 0.68
8 0.7
9 0.73
10 0.76
11 0.81
12 0.77
13 0.72
14 0.66
15 0.59
16 0.49
17 0.4
18 0.3
19 0.21
20 0.18
21 0.13
22 0.1
23 0.06
24 0.05
25 0.06
26 0.06
27 0.05
28 0.06
29 0.07
30 0.08
31 0.08
32 0.12
33 0.12
34 0.14
35 0.15
36 0.2
37 0.2
38 0.21
39 0.21
40 0.18
41 0.19
42 0.19
43 0.18
44 0.12
45 0.12
46 0.1
47 0.11
48 0.1
49 0.11
50 0.12
51 0.14
52 0.19
53 0.2
54 0.21
55 0.21
56 0.25
57 0.25
58 0.29
59 0.34
60 0.34
61 0.4
62 0.4
63 0.41
64 0.39
65 0.39
66 0.36
67 0.32
68 0.27
69 0.19
70 0.23
71 0.21
72 0.2
73 0.17
74 0.14
75 0.12
76 0.12
77 0.18
78 0.14
79 0.14
80 0.14
81 0.14
82 0.13
83 0.12
84 0.12
85 0.09
86 0.08
87 0.11
88 0.14
89 0.16
90 0.17
91 0.17
92 0.2
93 0.22
94 0.25
95 0.26
96 0.26
97 0.28
98 0.29
99 0.31
100 0.29
101 0.26
102 0.24
103 0.25
104 0.25
105 0.22
106 0.22
107 0.19
108 0.2
109 0.2
110 0.23
111 0.21
112 0.2
113 0.23
114 0.23
115 0.24
116 0.23
117 0.23
118 0.2
119 0.21
120 0.22
121 0.2
122 0.19
123 0.22
124 0.26
125 0.24