Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067Q3Q2

Protein Details
Accession A0A067Q3Q2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLMSRTRRRRPHRTIDRNRKHCQICNHydrophilic
NLS Segment(s)
PositionSequence
8-11RRRP
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MLMSRTRRRRPHRTIDRNRKHCQICNLLSTVSSRGSTRSVRSNLKMDLSRVHRPFRSLEESGLTAGVLFCFSRAHLAPTLYPLPTPQTQARNTYDAFDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.95
4 0.93
5 0.89
6 0.87
7 0.81
8 0.76
9 0.73
10 0.71
11 0.63
12 0.57
13 0.53
14 0.44
15 0.38
16 0.33
17 0.27
18 0.19
19 0.16
20 0.13
21 0.13
22 0.16
23 0.18
24 0.19
25 0.25
26 0.29
27 0.32
28 0.35
29 0.38
30 0.35
31 0.37
32 0.35
33 0.29
34 0.3
35 0.31
36 0.35
37 0.34
38 0.37
39 0.33
40 0.34
41 0.34
42 0.34
43 0.35
44 0.28
45 0.26
46 0.24
47 0.24
48 0.23
49 0.2
50 0.15
51 0.08
52 0.07
53 0.06
54 0.05
55 0.04
56 0.04
57 0.05
58 0.05
59 0.09
60 0.1
61 0.13
62 0.15
63 0.17
64 0.17
65 0.22
66 0.24
67 0.2
68 0.2
69 0.18
70 0.2
71 0.21
72 0.26
73 0.27
74 0.32
75 0.35
76 0.42
77 0.45
78 0.44
79 0.43