Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PZP0

Protein Details
Accession A0A067PZP0   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
115-135LSRRPNPPSASKKRRRDVPESHydrophilic
159-188DLEDYPKSEPPKKKKKKARRARDVEDWDPYBasic
NLS Segment(s)
PositionSequence
119-130PNPPSASKKRRR
167-180EPPKKKKKKARRAR
Subcellular Location(s) nucl 11.5, mito_nucl 11, mito 9.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSLMTKVGITKQNGEPFAGRLPQRFWQNPELLIAEYGHRLRGWPTDVPPTSPTKGSGVWTVGMAAALARMLAEGSISLRVRSGRSSHSSKSSHIESAPVSHSVPSTSAICREPILSRRPNPPSASKKRRRDVPESGKSLNLKDVAPTSSLAGKPQVGADLEDYPKSEPPKKKKKKARRARDVEDWDPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.35
4 0.37
5 0.37
6 0.32
7 0.28
8 0.31
9 0.35
10 0.43
11 0.45
12 0.45
13 0.47
14 0.48
15 0.45
16 0.44
17 0.39
18 0.31
19 0.27
20 0.22
21 0.16
22 0.17
23 0.17
24 0.15
25 0.13
26 0.13
27 0.14
28 0.18
29 0.2
30 0.2
31 0.23
32 0.31
33 0.32
34 0.34
35 0.35
36 0.36
37 0.34
38 0.32
39 0.3
40 0.23
41 0.24
42 0.23
43 0.23
44 0.19
45 0.17
46 0.16
47 0.14
48 0.12
49 0.1
50 0.08
51 0.05
52 0.04
53 0.03
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.07
63 0.07
64 0.07
65 0.09
66 0.1
67 0.11
68 0.13
69 0.14
70 0.15
71 0.21
72 0.26
73 0.27
74 0.33
75 0.33
76 0.33
77 0.35
78 0.32
79 0.28
80 0.23
81 0.23
82 0.16
83 0.17
84 0.17
85 0.14
86 0.12
87 0.11
88 0.11
89 0.1
90 0.1
91 0.09
92 0.1
93 0.09
94 0.11
95 0.12
96 0.12
97 0.12
98 0.13
99 0.14
100 0.18
101 0.24
102 0.28
103 0.32
104 0.39
105 0.44
106 0.47
107 0.48
108 0.52
109 0.56
110 0.61
111 0.68
112 0.7
113 0.75
114 0.78
115 0.83
116 0.81
117 0.78
118 0.78
119 0.78
120 0.77
121 0.73
122 0.67
123 0.62
124 0.57
125 0.5
126 0.42
127 0.33
128 0.24
129 0.2
130 0.21
131 0.18
132 0.17
133 0.17
134 0.15
135 0.17
136 0.18
137 0.17
138 0.17
139 0.17
140 0.16
141 0.16
142 0.17
143 0.13
144 0.14
145 0.15
146 0.17
147 0.19
148 0.19
149 0.19
150 0.19
151 0.22
152 0.27
153 0.34
154 0.39
155 0.48
156 0.59
157 0.69
158 0.78
159 0.85
160 0.91
161 0.94
162 0.95
163 0.96
164 0.96
165 0.95
166 0.92
167 0.92
168 0.89