Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067Q084

Protein Details
Accession A0A067Q084   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
44-64GFQLKCSIRRRRPPYVRRLSLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, cyto_nucl 7, mito 5, cysk 5, nucl 3.5, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MCPPGIGWICAIGIGFSSIHSATSSPPIIVGPGTEGLRINDLGGFQLKCSIRRRRPPYVRRLSLPTATSGPQMLARCVAVVVCGQFSVSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.08
5 0.07
6 0.08
7 0.08
8 0.09
9 0.09
10 0.13
11 0.14
12 0.11
13 0.12
14 0.11
15 0.11
16 0.11
17 0.1
18 0.07
19 0.08
20 0.09
21 0.09
22 0.1
23 0.09
24 0.11
25 0.11
26 0.09
27 0.07
28 0.07
29 0.07
30 0.09
31 0.08
32 0.07
33 0.13
34 0.13
35 0.17
36 0.25
37 0.34
38 0.4
39 0.51
40 0.58
41 0.64
42 0.74
43 0.79
44 0.83
45 0.83
46 0.8
47 0.73
48 0.73
49 0.66
50 0.6
51 0.52
52 0.43
53 0.35
54 0.31
55 0.28
56 0.22
57 0.18
58 0.18
59 0.18
60 0.16
61 0.15
62 0.14
63 0.14
64 0.13
65 0.12
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08