Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PXH1

Protein Details
Accession A0A067PXH1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
259-279ITLNSRAKLRRKLRPNFVDPTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, mito 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045339  DUF6534  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20152  DUF6534  
Amino Acid Sequences MSFTVSQIQEHPGSFLGAYLADLVLQAFQTGLLVDLSLKFWRRSHNESVGTRVLVAYVMFVALFQMGISFYSAWRVNVVHFGDWMVLLTLVWPDELQGLMTVALSSPVQAFLIWRCWIFTRKSWVVLIPLVSLLLASVVSAVYVSVGMFTIRFSTHGPLMTSIPVDTPFVLSLILTAALDFAITSTLLFFLSRSRSDVFSRKFDRVFQRLIMLSWEAAVAPCGCAIITAALYLVYGNGNFWYLFFRGILGKLYAMSLLITLNSRAKLRRKLRPNFVDPTLNLPPIEVHVTGSGHEGDDTTGTDSGSSAASAPPLESIVRPGITEKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.12
4 0.09
5 0.09
6 0.08
7 0.07
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.05
14 0.04
15 0.04
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.07
23 0.09
24 0.13
25 0.16
26 0.18
27 0.21
28 0.3
29 0.36
30 0.43
31 0.49
32 0.55
33 0.6
34 0.59
35 0.63
36 0.57
37 0.5
38 0.43
39 0.34
40 0.25
41 0.17
42 0.15
43 0.09
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.03
52 0.03
53 0.04
54 0.04
55 0.06
56 0.06
57 0.06
58 0.11
59 0.12
60 0.12
61 0.13
62 0.13
63 0.13
64 0.19
65 0.21
66 0.17
67 0.16
68 0.16
69 0.15
70 0.14
71 0.14
72 0.08
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.04
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06
98 0.07
99 0.11
100 0.12
101 0.12
102 0.12
103 0.14
104 0.19
105 0.21
106 0.24
107 0.28
108 0.29
109 0.32
110 0.32
111 0.31
112 0.29
113 0.27
114 0.23
115 0.14
116 0.12
117 0.1
118 0.09
119 0.07
120 0.05
121 0.04
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.06
140 0.07
141 0.09
142 0.1
143 0.11
144 0.12
145 0.12
146 0.13
147 0.12
148 0.11
149 0.09
150 0.09
151 0.08
152 0.08
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.02
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.04
176 0.04
177 0.06
178 0.1
179 0.1
180 0.13
181 0.14
182 0.17
183 0.2
184 0.29
185 0.3
186 0.35
187 0.38
188 0.39
189 0.39
190 0.43
191 0.47
192 0.43
193 0.42
194 0.35
195 0.34
196 0.31
197 0.3
198 0.26
199 0.19
200 0.14
201 0.12
202 0.11
203 0.07
204 0.06
205 0.07
206 0.05
207 0.05
208 0.05
209 0.05
210 0.04
211 0.04
212 0.05
213 0.05
214 0.05
215 0.04
216 0.04
217 0.04
218 0.05
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.05
225 0.06
226 0.06
227 0.06
228 0.09
229 0.09
230 0.1
231 0.09
232 0.1
233 0.11
234 0.12
235 0.13
236 0.11
237 0.11
238 0.1
239 0.11
240 0.1
241 0.08
242 0.07
243 0.06
244 0.05
245 0.06
246 0.06
247 0.08
248 0.11
249 0.13
250 0.16
251 0.22
252 0.29
253 0.39
254 0.47
255 0.55
256 0.63
257 0.71
258 0.79
259 0.83
260 0.82
261 0.78
262 0.74
263 0.71
264 0.61
265 0.59
266 0.53
267 0.45
268 0.37
269 0.31
270 0.27
271 0.23
272 0.25
273 0.17
274 0.14
275 0.15
276 0.16
277 0.16
278 0.18
279 0.15
280 0.12
281 0.12
282 0.11
283 0.09
284 0.1
285 0.11
286 0.11
287 0.11
288 0.1
289 0.1
290 0.1
291 0.1
292 0.1
293 0.09
294 0.07
295 0.07
296 0.09
297 0.09
298 0.09
299 0.09
300 0.1
301 0.11
302 0.11
303 0.14
304 0.17
305 0.18
306 0.18
307 0.2