Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PVY9

Protein Details
Accession A0A067PVY9   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
264-285GLKLTPPKVKRWVRERKTTESLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, cyto 10.5, nucl 9, cyto_pero 7.666, pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR018712  DUF2235  
Pfam View protein in Pfam  
PF09994  DUF2235  
Amino Acid Sequences GRNLIVCIDGTSNQFGPNNTNIVELYSRIIKDDSQLPQLTYYNSGIGTYAKPSWRSFSHLKQVIDNKIDLAIAWNFEKVLLGAYRWLSDNYDPGDKIFLFGFSRGAYQVRSLAGMISEVGLIRRGNEEQIPFAFELYAGADALTAPFKDTFSWPNGRVHFVGAWDTVSSVGIIRGKSMPGTDTFNDYVCYFRHALALDERRVKFLPEYIRGGDTVHGGSGVESGRSRPRIKEVWFAGCHSDMNTELNNATIPLLWMGVEAELAGLKLTPPKVKRWVRERKTTESLSLGWWPFEILPFKRLSYKNAKGATWYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.26
5 0.26
6 0.23
7 0.24
8 0.21
9 0.22
10 0.22
11 0.18
12 0.18
13 0.19
14 0.19
15 0.19
16 0.2
17 0.18
18 0.2
19 0.27
20 0.27
21 0.3
22 0.31
23 0.3
24 0.32
25 0.33
26 0.31
27 0.28
28 0.25
29 0.2
30 0.18
31 0.17
32 0.15
33 0.15
34 0.15
35 0.14
36 0.17
37 0.2
38 0.23
39 0.24
40 0.29
41 0.29
42 0.35
43 0.39
44 0.43
45 0.49
46 0.53
47 0.53
48 0.55
49 0.6
50 0.6
51 0.55
52 0.47
53 0.37
54 0.31
55 0.29
56 0.22
57 0.18
58 0.12
59 0.12
60 0.12
61 0.11
62 0.11
63 0.11
64 0.11
65 0.08
66 0.09
67 0.08
68 0.08
69 0.1
70 0.11
71 0.12
72 0.13
73 0.14
74 0.13
75 0.14
76 0.17
77 0.17
78 0.2
79 0.19
80 0.18
81 0.2
82 0.18
83 0.18
84 0.14
85 0.13
86 0.11
87 0.12
88 0.12
89 0.1
90 0.11
91 0.11
92 0.11
93 0.1
94 0.1
95 0.12
96 0.11
97 0.11
98 0.1
99 0.09
100 0.08
101 0.08
102 0.07
103 0.05
104 0.05
105 0.04
106 0.04
107 0.06
108 0.06
109 0.07
110 0.08
111 0.09
112 0.1
113 0.12
114 0.13
115 0.13
116 0.13
117 0.14
118 0.12
119 0.12
120 0.1
121 0.08
122 0.07
123 0.06
124 0.06
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.05
131 0.04
132 0.05
133 0.05
134 0.05
135 0.07
136 0.08
137 0.1
138 0.14
139 0.18
140 0.19
141 0.24
142 0.25
143 0.26
144 0.25
145 0.24
146 0.2
147 0.16
148 0.16
149 0.11
150 0.1
151 0.08
152 0.08
153 0.06
154 0.06
155 0.05
156 0.04
157 0.05
158 0.07
159 0.07
160 0.08
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.09
167 0.13
168 0.13
169 0.16
170 0.17
171 0.17
172 0.17
173 0.17
174 0.16
175 0.12
176 0.15
177 0.12
178 0.12
179 0.14
180 0.13
181 0.15
182 0.21
183 0.26
184 0.27
185 0.33
186 0.33
187 0.34
188 0.34
189 0.33
190 0.26
191 0.26
192 0.29
193 0.26
194 0.29
195 0.28
196 0.28
197 0.27
198 0.27
199 0.23
200 0.17
201 0.13
202 0.09
203 0.08
204 0.07
205 0.07
206 0.08
207 0.07
208 0.07
209 0.07
210 0.1
211 0.16
212 0.21
213 0.24
214 0.24
215 0.3
216 0.36
217 0.4
218 0.46
219 0.45
220 0.48
221 0.47
222 0.46
223 0.43
224 0.37
225 0.33
226 0.25
227 0.23
228 0.15
229 0.16
230 0.15
231 0.13
232 0.12
233 0.12
234 0.11
235 0.1
236 0.09
237 0.07
238 0.07
239 0.06
240 0.06
241 0.06
242 0.06
243 0.06
244 0.05
245 0.05
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.09
254 0.12
255 0.19
256 0.22
257 0.29
258 0.4
259 0.48
260 0.57
261 0.63
262 0.72
263 0.73
264 0.82
265 0.82
266 0.8
267 0.8
268 0.74
269 0.67
270 0.59
271 0.52
272 0.45
273 0.45
274 0.36
275 0.29
276 0.25
277 0.23
278 0.19
279 0.23
280 0.26
281 0.21
282 0.25
283 0.27
284 0.29
285 0.36
286 0.38
287 0.42
288 0.46
289 0.52
290 0.57
291 0.59
292 0.58