Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067QPF0

Protein Details
Accession A0A067QPF0    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-115LDLRAKRTRAIRRRLTKHEKSLKTEKQHKKDIHFBasic
NLS Segment(s)
PositionSequence
85-115RAKRTRAIRRRLTKHEKSLKTEKQHKKDIHF
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKTDLTKQLTELKNELLQLRVQKVVGGSAAKLTKINTVRKSIARVLTVMNHKARQNLREFYKDKKYLPLDLRAKRTRAIRRRLTKHEKSLKTEKQHKKDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.42
4 0.47
5 0.45
6 0.46
7 0.46
8 0.52
9 0.5
10 0.5
11 0.47
12 0.41
13 0.36
14 0.32
15 0.3
16 0.22
17 0.22
18 0.22
19 0.22
20 0.21
21 0.19
22 0.18
23 0.17
24 0.16
25 0.15
26 0.12
27 0.1
28 0.12
29 0.13
30 0.12
31 0.13
32 0.12
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.29
44 0.27
45 0.23
46 0.25
47 0.26
48 0.26
49 0.23
50 0.23
51 0.23
52 0.28
53 0.3
54 0.29
55 0.32
56 0.34
57 0.35
58 0.41
59 0.42
60 0.42
61 0.5
62 0.49
63 0.45
64 0.47
65 0.46
66 0.46
67 0.47
68 0.51
69 0.5
70 0.52
71 0.6
72 0.57
73 0.56
74 0.53
75 0.58
76 0.59
77 0.59
78 0.63
79 0.65
80 0.7
81 0.77
82 0.84
83 0.86
84 0.84
85 0.86
86 0.86
87 0.82
88 0.8
89 0.82
90 0.8
91 0.8
92 0.82
93 0.82
94 0.8
95 0.83
96 0.81
97 0.78
98 0.79
99 0.8
100 0.8
101 0.78
102 0.72
103 0.72
104 0.75