Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067Q2B2

Protein Details
Accession A0A067Q2B2    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-48NGYTRETPYRRCKPPNFDIDATHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, mito 9, nucl 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000898  Indolamine_dOase  
IPR037217  Trp/Indoleamine_2_3_dOase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
GO:0019441  P:tryptophan catabolic process to kynurenine  
Pfam View protein in Pfam  
PF01231  IDO  
Amino Acid Sequences MHMINNLPQSYRSVARLALSLLCETLNGYTRETPYRRCKPPNFDIDATTGFLPSQPLPKLPETFDCWETALSEAPFQVRLGADEDEEALDYRSSSAAWRANIRKVSEYFICEVPPMKLTTCQWSVIDIAPLRNDRRMLQRSHLVLAFLVHYFVHSTPPDENGDPIVVPRSLAVPLVEISQILEMAPVLTFADTVLWNWTTINPDLPVSAENIRFLNLLSGTDDEHNFYLVSARAELRGAEILRIIEDYNGIRDTGELTSISKISKDLARLAEIIAEMTEIVNSVRNVVDPHVFYFAVRPWWKGSDGDGPSSPGWIFEGVPDQDKLDLSGPSAGQSSVMHALDIFLDIDHKLEKRRFPAPSENNKKADGSFMERMRRYMPGKHRDYLENLSASSRPLRELAQRTPAVREPYNLAVKALKKFRDEHIKIACLYVVTMSRSAPLTCPVGAMMMKMERGGGGGPARGTGGNELSTLLKAGRDATARAMLEERNWGPGKSWIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.27
4 0.25
5 0.23
6 0.21
7 0.19
8 0.18
9 0.16
10 0.14
11 0.13
12 0.14
13 0.17
14 0.16
15 0.19
16 0.23
17 0.27
18 0.36
19 0.39
20 0.45
21 0.51
22 0.59
23 0.66
24 0.72
25 0.78
26 0.78
27 0.84
28 0.85
29 0.82
30 0.75
31 0.67
32 0.62
33 0.54
34 0.47
35 0.37
36 0.27
37 0.19
38 0.17
39 0.17
40 0.14
41 0.19
42 0.19
43 0.21
44 0.26
45 0.31
46 0.33
47 0.34
48 0.37
49 0.37
50 0.4
51 0.39
52 0.35
53 0.32
54 0.29
55 0.26
56 0.22
57 0.19
58 0.15
59 0.15
60 0.14
61 0.14
62 0.15
63 0.14
64 0.15
65 0.11
66 0.12
67 0.14
68 0.14
69 0.13
70 0.13
71 0.14
72 0.11
73 0.12
74 0.11
75 0.09
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.14
83 0.17
84 0.19
85 0.28
86 0.32
87 0.39
88 0.43
89 0.45
90 0.44
91 0.42
92 0.44
93 0.39
94 0.38
95 0.34
96 0.3
97 0.28
98 0.23
99 0.23
100 0.19
101 0.18
102 0.16
103 0.14
104 0.18
105 0.19
106 0.25
107 0.26
108 0.26
109 0.24
110 0.24
111 0.25
112 0.22
113 0.25
114 0.19
115 0.19
116 0.2
117 0.24
118 0.25
119 0.26
120 0.26
121 0.25
122 0.33
123 0.38
124 0.37
125 0.39
126 0.44
127 0.43
128 0.45
129 0.42
130 0.32
131 0.27
132 0.24
133 0.2
134 0.13
135 0.11
136 0.08
137 0.07
138 0.08
139 0.09
140 0.12
141 0.11
142 0.13
143 0.13
144 0.16
145 0.19
146 0.18
147 0.18
148 0.15
149 0.15
150 0.13
151 0.13
152 0.12
153 0.09
154 0.09
155 0.08
156 0.08
157 0.08
158 0.09
159 0.08
160 0.07
161 0.07
162 0.08
163 0.08
164 0.07
165 0.07
166 0.06
167 0.06
168 0.05
169 0.05
170 0.03
171 0.04
172 0.04
173 0.03
174 0.04
175 0.03
176 0.03
177 0.03
178 0.05
179 0.05
180 0.05
181 0.07
182 0.08
183 0.08
184 0.08
185 0.09
186 0.11
187 0.11
188 0.12
189 0.11
190 0.11
191 0.11
192 0.11
193 0.1
194 0.1
195 0.13
196 0.11
197 0.12
198 0.12
199 0.12
200 0.12
201 0.11
202 0.11
203 0.08
204 0.08
205 0.08
206 0.08
207 0.08
208 0.1
209 0.1
210 0.09
211 0.09
212 0.09
213 0.08
214 0.07
215 0.08
216 0.08
217 0.08
218 0.08
219 0.08
220 0.08
221 0.08
222 0.08
223 0.08
224 0.09
225 0.09
226 0.08
227 0.08
228 0.08
229 0.08
230 0.08
231 0.07
232 0.05
233 0.06
234 0.06
235 0.06
236 0.07
237 0.07
238 0.06
239 0.06
240 0.08
241 0.07
242 0.07
243 0.06
244 0.07
245 0.08
246 0.08
247 0.08
248 0.07
249 0.07
250 0.08
251 0.1
252 0.11
253 0.14
254 0.14
255 0.15
256 0.15
257 0.15
258 0.14
259 0.12
260 0.11
261 0.07
262 0.06
263 0.04
264 0.04
265 0.04
266 0.03
267 0.03
268 0.06
269 0.05
270 0.07
271 0.07
272 0.07
273 0.08
274 0.1
275 0.12
276 0.1
277 0.12
278 0.13
279 0.13
280 0.13
281 0.14
282 0.14
283 0.19
284 0.19
285 0.2
286 0.19
287 0.22
288 0.23
289 0.22
290 0.23
291 0.24
292 0.24
293 0.26
294 0.24
295 0.25
296 0.23
297 0.24
298 0.2
299 0.12
300 0.11
301 0.09
302 0.09
303 0.07
304 0.12
305 0.11
306 0.13
307 0.14
308 0.13
309 0.13
310 0.13
311 0.14
312 0.11
313 0.1
314 0.09
315 0.11
316 0.11
317 0.11
318 0.12
319 0.1
320 0.09
321 0.09
322 0.1
323 0.12
324 0.12
325 0.11
326 0.1
327 0.1
328 0.1
329 0.1
330 0.08
331 0.04
332 0.05
333 0.05
334 0.06
335 0.08
336 0.09
337 0.15
338 0.19
339 0.24
340 0.28
341 0.35
342 0.37
343 0.41
344 0.51
345 0.55
346 0.62
347 0.67
348 0.7
349 0.66
350 0.64
351 0.6
352 0.49
353 0.43
354 0.35
355 0.33
356 0.32
357 0.34
358 0.41
359 0.4
360 0.42
361 0.39
362 0.42
363 0.38
364 0.4
365 0.45
366 0.48
367 0.53
368 0.55
369 0.57
370 0.54
371 0.57
372 0.53
373 0.48
374 0.39
375 0.34
376 0.32
377 0.29
378 0.27
379 0.25
380 0.2
381 0.17
382 0.17
383 0.19
384 0.26
385 0.32
386 0.35
387 0.4
388 0.43
389 0.42
390 0.46
391 0.48
392 0.46
393 0.41
394 0.38
395 0.34
396 0.38
397 0.42
398 0.38
399 0.33
400 0.33
401 0.36
402 0.41
403 0.44
404 0.41
405 0.39
406 0.42
407 0.49
408 0.55
409 0.53
410 0.55
411 0.55
412 0.55
413 0.51
414 0.49
415 0.42
416 0.3
417 0.27
418 0.21
419 0.16
420 0.15
421 0.15
422 0.14
423 0.16
424 0.17
425 0.18
426 0.17
427 0.18
428 0.18
429 0.17
430 0.18
431 0.16
432 0.17
433 0.16
434 0.15
435 0.15
436 0.14
437 0.14
438 0.14
439 0.14
440 0.11
441 0.11
442 0.11
443 0.12
444 0.12
445 0.13
446 0.13
447 0.14
448 0.15
449 0.15
450 0.15
451 0.15
452 0.16
453 0.14
454 0.14
455 0.15
456 0.15
457 0.15
458 0.15
459 0.12
460 0.11
461 0.11
462 0.12
463 0.15
464 0.16
465 0.18
466 0.21
467 0.27
468 0.26
469 0.27
470 0.28
471 0.25
472 0.25
473 0.31
474 0.28
475 0.3
476 0.31
477 0.3
478 0.29