Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067Q6E4

Protein Details
Accession A0A067Q6E4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
99-123MPDEFAHKPKPKKKVRGWGPAVQNGHydrophilic
NLS Segment(s)
PositionSequence
105-132HKPKPKKKVRGWGPAVQNGKRIRSRRIK
Subcellular Location(s) mito 20, cyto_mito 12.333, mito_nucl 11.833, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MSHWLAARLRSFSPSFTRCLQTFAGQPRRLPQPPSRRDDIRTPQAFLKAIGRQADTMLSPKRWKELWDTRGPDLKEKGLSVKDRRYILWCMHKYRNGLMPDEFAHKPKPKKKVRGWGPAVQNGKRIRSRRIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.35
4 0.39
5 0.34
6 0.37
7 0.36
8 0.3
9 0.34
10 0.4
11 0.46
12 0.43
13 0.44
14 0.45
15 0.52
16 0.52
17 0.51
18 0.5
19 0.51
20 0.57
21 0.62
22 0.64
23 0.59
24 0.6
25 0.64
26 0.63
27 0.62
28 0.56
29 0.52
30 0.48
31 0.47
32 0.44
33 0.35
34 0.31
35 0.23
36 0.24
37 0.23
38 0.21
39 0.18
40 0.18
41 0.18
42 0.14
43 0.15
44 0.15
45 0.15
46 0.17
47 0.17
48 0.2
49 0.2
50 0.21
51 0.25
52 0.33
53 0.37
54 0.42
55 0.45
56 0.45
57 0.5
58 0.49
59 0.44
60 0.36
61 0.32
62 0.25
63 0.22
64 0.23
65 0.22
66 0.28
67 0.3
68 0.34
69 0.37
70 0.37
71 0.38
72 0.38
73 0.37
74 0.37
75 0.42
76 0.41
77 0.43
78 0.48
79 0.51
80 0.49
81 0.49
82 0.5
83 0.41
84 0.39
85 0.34
86 0.3
87 0.28
88 0.31
89 0.29
90 0.24
91 0.29
92 0.34
93 0.43
94 0.47
95 0.56
96 0.61
97 0.71
98 0.78
99 0.82
100 0.85
101 0.86
102 0.86
103 0.84
104 0.81
105 0.79
106 0.76
107 0.67
108 0.64
109 0.58
110 0.59
111 0.59
112 0.56