Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PUG3

Protein Details
Accession A0A067PUG3    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-76KVVERDEESRRNKKREKRERDRERKREKAAAKBasic
177-202SPSTSSPQPSRKKRAPVRKGWKGWVEHydrophilic
NLS Segment(s)
PositionSequence
54-80RRNKKREKRERDRERKREKAAAKAREK
186-198SRKKRAPVRKGWK
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MPPHAPMNSYKRQRRTATSVLAGDFDIKPPRDALTSLLNGVGPYKVVERDEESRRNKKREKRERDRERKREKAAAKAREKAALATAGPSNATPSIIPPIKQNTPAPMPTAAASSFWRARPAIHIPSAQRSLSVTPPPMPSSPRSTPEPSNASTYSRTSSKRPRTPSDYDDHNPGVVSPSTSSPQPSRKKRAPVRKGWKGWVEGSPPPSEKLINLDHVPVLQERRTRSGKSFDAIGVGKDSWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.73
4 0.71
5 0.68
6 0.62
7 0.54
8 0.48
9 0.4
10 0.35
11 0.27
12 0.23
13 0.23
14 0.22
15 0.22
16 0.22
17 0.23
18 0.22
19 0.22
20 0.22
21 0.22
22 0.23
23 0.22
24 0.22
25 0.21
26 0.19
27 0.19
28 0.16
29 0.09
30 0.08
31 0.1
32 0.11
33 0.12
34 0.14
35 0.18
36 0.24
37 0.32
38 0.4
39 0.46
40 0.54
41 0.62
42 0.69
43 0.73
44 0.76
45 0.8
46 0.82
47 0.85
48 0.86
49 0.9
50 0.92
51 0.94
52 0.96
53 0.96
54 0.95
55 0.93
56 0.88
57 0.86
58 0.79
59 0.78
60 0.76
61 0.75
62 0.71
63 0.68
64 0.63
65 0.57
66 0.54
67 0.43
68 0.35
69 0.27
70 0.2
71 0.16
72 0.15
73 0.11
74 0.11
75 0.1
76 0.09
77 0.08
78 0.08
79 0.06
80 0.07
81 0.13
82 0.14
83 0.15
84 0.16
85 0.22
86 0.23
87 0.27
88 0.27
89 0.25
90 0.27
91 0.27
92 0.26
93 0.21
94 0.2
95 0.17
96 0.17
97 0.13
98 0.11
99 0.11
100 0.12
101 0.14
102 0.14
103 0.15
104 0.14
105 0.14
106 0.17
107 0.22
108 0.22
109 0.22
110 0.24
111 0.23
112 0.27
113 0.29
114 0.25
115 0.2
116 0.18
117 0.17
118 0.18
119 0.19
120 0.16
121 0.16
122 0.18
123 0.2
124 0.2
125 0.2
126 0.2
127 0.26
128 0.28
129 0.29
130 0.32
131 0.34
132 0.35
133 0.39
134 0.4
135 0.34
136 0.35
137 0.33
138 0.3
139 0.28
140 0.27
141 0.24
142 0.25
143 0.26
144 0.28
145 0.38
146 0.46
147 0.51
148 0.57
149 0.62
150 0.65
151 0.69
152 0.67
153 0.62
154 0.59
155 0.54
156 0.52
157 0.45
158 0.38
159 0.31
160 0.26
161 0.24
162 0.16
163 0.15
164 0.11
165 0.12
166 0.14
167 0.15
168 0.18
169 0.2
170 0.3
171 0.39
172 0.47
173 0.54
174 0.6
175 0.71
176 0.77
177 0.83
178 0.84
179 0.85
180 0.87
181 0.88
182 0.86
183 0.83
184 0.79
185 0.72
186 0.65
187 0.6
188 0.54
189 0.48
190 0.45
191 0.42
192 0.37
193 0.35
194 0.33
195 0.28
196 0.24
197 0.25
198 0.25
199 0.25
200 0.25
201 0.25
202 0.23
203 0.23
204 0.24
205 0.22
206 0.23
207 0.23
208 0.26
209 0.28
210 0.36
211 0.4
212 0.43
213 0.45
214 0.49
215 0.49
216 0.47
217 0.46
218 0.39
219 0.4
220 0.36
221 0.32
222 0.27