Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067Q288

Protein Details
Accession A0A067Q288    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-75QIWRRPQPNRHRYAVRRRSKBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito_nucl 10.833, cyto 5.5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MHPCLSEFPSNMFYEGTLQNGVTAPERLRKNVDFPWPIPDTPMFFYQNLDSYQVLQIWRRPQPNRHRYAVRRRSKWQALTLSRAERRIILF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.14
5 0.13
6 0.13
7 0.13
8 0.14
9 0.11
10 0.13
11 0.12
12 0.19
13 0.2
14 0.22
15 0.26
16 0.26
17 0.3
18 0.33
19 0.4
20 0.37
21 0.36
22 0.4
23 0.37
24 0.36
25 0.33
26 0.28
27 0.22
28 0.2
29 0.23
30 0.18
31 0.16
32 0.17
33 0.16
34 0.17
35 0.16
36 0.16
37 0.12
38 0.12
39 0.12
40 0.13
41 0.14
42 0.13
43 0.16
44 0.2
45 0.26
46 0.32
47 0.36
48 0.44
49 0.54
50 0.63
51 0.65
52 0.66
53 0.7
54 0.72
55 0.79
56 0.8
57 0.8
58 0.77
59 0.77
60 0.8
61 0.79
62 0.76
63 0.73
64 0.73
65 0.67
66 0.67
67 0.67
68 0.66
69 0.61
70 0.58
71 0.51