Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PE25

Protein Details
Accession A0A067PE25    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-80GLTMKTTRCKSRRRTRRGLKGSDLKPKRREPKKKKVRKQEINVAAFBasic
NLS Segment(s)
PositionSequence
44-72KSRRRTRRGLKGSDLKPKRREPKKKKVRK
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
Amino Acid Sequences MHGGLEELEDWGRGGGGGINGGENTQKHILDRLNGLTMKTTRCKSRRRTRRGLKGSDLKPKRREPKKKKVRKQEINVAAFTDEAALAALESDEVLHLSFTRDLHCLRNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.07
6 0.07
7 0.07
8 0.08
9 0.1
10 0.08
11 0.12
12 0.14
13 0.14
14 0.15
15 0.19
16 0.2
17 0.2
18 0.23
19 0.2
20 0.22
21 0.22
22 0.21
23 0.21
24 0.21
25 0.22
26 0.25
27 0.26
28 0.31
29 0.37
30 0.45
31 0.52
32 0.62
33 0.69
34 0.73
35 0.82
36 0.83
37 0.88
38 0.88
39 0.83
40 0.79
41 0.77
42 0.73
43 0.72
44 0.69
45 0.65
46 0.63
47 0.66
48 0.69
49 0.71
50 0.77
51 0.77
52 0.82
53 0.86
54 0.9
55 0.91
56 0.92
57 0.93
58 0.92
59 0.9
60 0.9
61 0.88
62 0.8
63 0.7
64 0.6
65 0.48
66 0.38
67 0.29
68 0.19
69 0.09
70 0.06
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.04
83 0.05
84 0.08
85 0.1
86 0.11
87 0.13
88 0.16
89 0.18