Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PK45

Protein Details
Accession A0A067PK45    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
25-45AKVVKKGRKGVKKGKATKKVABasic
NLS Segment(s)
PositionSequence
26-49KVVKKGRKGVKKGKATKKVAEKRQ
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MSTPVAATQPSLASRVAPAPAAATAKVVKKGRKGVKKGKATKKVAEKRQEKSAADLDAEMEDYTASNAPAVVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.12
5 0.11
6 0.1
7 0.12
8 0.12
9 0.11
10 0.11
11 0.13
12 0.14
13 0.21
14 0.24
15 0.26
16 0.3
17 0.4
18 0.47
19 0.53
20 0.6
21 0.63
22 0.68
23 0.75
24 0.8
25 0.81
26 0.82
27 0.78
28 0.76
29 0.77
30 0.76
31 0.75
32 0.75
33 0.72
34 0.66
35 0.71
36 0.7
37 0.6
38 0.56
39 0.52
40 0.43
41 0.37
42 0.32
43 0.24
44 0.18
45 0.18
46 0.13
47 0.08
48 0.07
49 0.06
50 0.08
51 0.08
52 0.07
53 0.07