Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PL41

Protein Details
Accession A0A067PL41    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
527-566QMPKETTKSTKSKKKAADKAEKAPRAKAKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
534-563KSTKSKKKAADKAEKAPRAKAKKDPNAPKR
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020097  PsdUridine_synth_TruA_a/b_dom  
IPR020095  PsdUridine_synth_TruA_C  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF00505  HMG_box  
PF01416  PseudoU_synth_1  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSPPSYENWTREQLIARINEIERLPASHTVKSSSDLISSHPDKKGQKPFVFSSHPRRKIALKFCYSGWEYNGLAFQNIPTPLPTVESVLFDALAFTRLIDPSKGFDGCGWEKCGRTDRGVSAAGQVISLWVRSALGQNGVGEERRNGSEVKLEEDGSGSEAVPDLSSHDALVDCLEGEDILSSTPLLPEITELQYVSKLNNVLPPTIRILAWSPVADDFSARFDCQHRHYKYFFTSHGLDVSRMQEAAQRLVGEHDFRNLCKLDASKQITQFRRNILRADVNPVEDSQPEGSPDKMFVLDLIGSAFLYHQVRHIMAILFLVGTGLEQPSVVSALLNADPDHREIPREGEQPIELVDRKPLYEMADSLPLVLWDCAYDDSRIQWRTDGEATSRRQGPEANLYNQLHSIASRSHIHTVLDRHFLAAAARYHPAPAMHFPLSPNTTSVTKPGMLSVPLGGGSYRRTGKYVPLLQRKRLDSVEVVNERYRVGKGDRRAARKASAAVDERDGDEDTRVSAEAVSLAVLIGAQMPKETTKSTKSKKKAADKAEKAPRAKAKKDPNAPKRALSAYMFFSSDWRERIKAENPDAGFGEVGKLLGAKWKEMDDEEKKPYVEQAAKDKERAEEEKAAYENKKDAGSGGSGAEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.36
4 0.36
5 0.34
6 0.36
7 0.32
8 0.31
9 0.25
10 0.25
11 0.26
12 0.29
13 0.32
14 0.31
15 0.32
16 0.33
17 0.33
18 0.35
19 0.34
20 0.27
21 0.26
22 0.23
23 0.24
24 0.29
25 0.33
26 0.36
27 0.36
28 0.42
29 0.45
30 0.54
31 0.62
32 0.63
33 0.64
34 0.64
35 0.66
36 0.67
37 0.7
38 0.68
39 0.68
40 0.69
41 0.71
42 0.68
43 0.66
44 0.66
45 0.67
46 0.7
47 0.68
48 0.64
49 0.58
50 0.56
51 0.6
52 0.55
53 0.48
54 0.4
55 0.35
56 0.29
57 0.28
58 0.3
59 0.23
60 0.2
61 0.17
62 0.16
63 0.16
64 0.16
65 0.16
66 0.14
67 0.15
68 0.15
69 0.18
70 0.18
71 0.16
72 0.16
73 0.18
74 0.18
75 0.16
76 0.16
77 0.13
78 0.13
79 0.1
80 0.1
81 0.08
82 0.07
83 0.09
84 0.1
85 0.12
86 0.13
87 0.14
88 0.16
89 0.2
90 0.2
91 0.18
92 0.18
93 0.24
94 0.27
95 0.29
96 0.32
97 0.3
98 0.31
99 0.35
100 0.41
101 0.36
102 0.37
103 0.38
104 0.35
105 0.37
106 0.37
107 0.33
108 0.28
109 0.29
110 0.24
111 0.19
112 0.17
113 0.13
114 0.12
115 0.11
116 0.09
117 0.06
118 0.06
119 0.07
120 0.1
121 0.1
122 0.12
123 0.13
124 0.13
125 0.15
126 0.16
127 0.16
128 0.14
129 0.14
130 0.15
131 0.14
132 0.16
133 0.15
134 0.14
135 0.19
136 0.19
137 0.22
138 0.21
139 0.21
140 0.19
141 0.19
142 0.19
143 0.14
144 0.14
145 0.1
146 0.08
147 0.07
148 0.07
149 0.07
150 0.06
151 0.07
152 0.08
153 0.08
154 0.08
155 0.08
156 0.08
157 0.08
158 0.09
159 0.07
160 0.05
161 0.05
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.06
176 0.09
177 0.11
178 0.11
179 0.11
180 0.11
181 0.14
182 0.14
183 0.13
184 0.13
185 0.12
186 0.12
187 0.17
188 0.17
189 0.17
190 0.17
191 0.19
192 0.2
193 0.2
194 0.19
195 0.16
196 0.17
197 0.17
198 0.17
199 0.16
200 0.13
201 0.12
202 0.13
203 0.12
204 0.1
205 0.09
206 0.11
207 0.12
208 0.11
209 0.12
210 0.14
211 0.18
212 0.24
213 0.33
214 0.34
215 0.38
216 0.4
217 0.43
218 0.45
219 0.46
220 0.41
221 0.36
222 0.33
223 0.29
224 0.31
225 0.27
226 0.23
227 0.2
228 0.2
229 0.16
230 0.14
231 0.13
232 0.13
233 0.13
234 0.14
235 0.13
236 0.12
237 0.11
238 0.13
239 0.14
240 0.13
241 0.12
242 0.16
243 0.15
244 0.15
245 0.19
246 0.18
247 0.17
248 0.17
249 0.18
250 0.17
251 0.25
252 0.3
253 0.31
254 0.37
255 0.45
256 0.46
257 0.5
258 0.49
259 0.47
260 0.49
261 0.47
262 0.42
263 0.38
264 0.39
265 0.35
266 0.39
267 0.33
268 0.27
269 0.26
270 0.24
271 0.22
272 0.16
273 0.16
274 0.11
275 0.1
276 0.11
277 0.11
278 0.11
279 0.11
280 0.11
281 0.1
282 0.09
283 0.08
284 0.07
285 0.07
286 0.06
287 0.06
288 0.05
289 0.05
290 0.04
291 0.04
292 0.04
293 0.06
294 0.06
295 0.06
296 0.08
297 0.09
298 0.09
299 0.09
300 0.11
301 0.08
302 0.08
303 0.08
304 0.06
305 0.05
306 0.05
307 0.04
308 0.03
309 0.02
310 0.03
311 0.03
312 0.03
313 0.03
314 0.03
315 0.03
316 0.04
317 0.04
318 0.03
319 0.03
320 0.05
321 0.05
322 0.06
323 0.06
324 0.07
325 0.07
326 0.09
327 0.1
328 0.09
329 0.1
330 0.1
331 0.14
332 0.19
333 0.2
334 0.19
335 0.19
336 0.19
337 0.17
338 0.18
339 0.16
340 0.11
341 0.1
342 0.12
343 0.12
344 0.12
345 0.12
346 0.12
347 0.12
348 0.12
349 0.13
350 0.11
351 0.14
352 0.14
353 0.13
354 0.12
355 0.1
356 0.1
357 0.09
358 0.07
359 0.04
360 0.05
361 0.06
362 0.07
363 0.08
364 0.07
365 0.1
366 0.16
367 0.17
368 0.17
369 0.17
370 0.17
371 0.2
372 0.21
373 0.2
374 0.17
375 0.23
376 0.25
377 0.28
378 0.31
379 0.28
380 0.27
381 0.27
382 0.27
383 0.3
384 0.33
385 0.3
386 0.34
387 0.34
388 0.34
389 0.33
390 0.3
391 0.21
392 0.16
393 0.15
394 0.08
395 0.11
396 0.14
397 0.15
398 0.18
399 0.19
400 0.19
401 0.21
402 0.25
403 0.25
404 0.27
405 0.25
406 0.22
407 0.21
408 0.21
409 0.18
410 0.17
411 0.15
412 0.13
413 0.14
414 0.14
415 0.14
416 0.14
417 0.15
418 0.13
419 0.14
420 0.17
421 0.18
422 0.19
423 0.19
424 0.23
425 0.25
426 0.23
427 0.21
428 0.18
429 0.18
430 0.18
431 0.2
432 0.17
433 0.16
434 0.16
435 0.17
436 0.16
437 0.14
438 0.14
439 0.13
440 0.1
441 0.09
442 0.09
443 0.08
444 0.07
445 0.08
446 0.13
447 0.15
448 0.16
449 0.17
450 0.18
451 0.24
452 0.32
453 0.39
454 0.43
455 0.52
456 0.56
457 0.62
458 0.68
459 0.65
460 0.6
461 0.53
462 0.46
463 0.37
464 0.37
465 0.39
466 0.34
467 0.35
468 0.32
469 0.31
470 0.29
471 0.28
472 0.24
473 0.18
474 0.21
475 0.25
476 0.29
477 0.39
478 0.46
479 0.51
480 0.55
481 0.56
482 0.54
483 0.51
484 0.49
485 0.42
486 0.41
487 0.38
488 0.35
489 0.34
490 0.31
491 0.28
492 0.26
493 0.23
494 0.17
495 0.15
496 0.13
497 0.11
498 0.11
499 0.11
500 0.09
501 0.08
502 0.07
503 0.07
504 0.06
505 0.06
506 0.05
507 0.05
508 0.04
509 0.04
510 0.04
511 0.05
512 0.06
513 0.06
514 0.06
515 0.07
516 0.09
517 0.11
518 0.14
519 0.16
520 0.24
521 0.34
522 0.44
523 0.54
524 0.6
525 0.68
526 0.75
527 0.81
528 0.82
529 0.83
530 0.84
531 0.81
532 0.84
533 0.86
534 0.83
535 0.75
536 0.74
537 0.73
538 0.7
539 0.69
540 0.68
541 0.68
542 0.71
543 0.79
544 0.82
545 0.82
546 0.84
547 0.81
548 0.75
549 0.7
550 0.62
551 0.56
552 0.48
553 0.41
554 0.35
555 0.34
556 0.31
557 0.26
558 0.25
559 0.26
560 0.27
561 0.27
562 0.26
563 0.26
564 0.27
565 0.34
566 0.4
567 0.44
568 0.45
569 0.5
570 0.46
571 0.48
572 0.47
573 0.41
574 0.32
575 0.23
576 0.19
577 0.12
578 0.11
579 0.09
580 0.08
581 0.07
582 0.14
583 0.15
584 0.15
585 0.16
586 0.18
587 0.2
588 0.23
589 0.32
590 0.32
591 0.39
592 0.43
593 0.45
594 0.43
595 0.42
596 0.42
597 0.41
598 0.4
599 0.38
600 0.43
601 0.5
602 0.53
603 0.55
604 0.54
605 0.5
606 0.52
607 0.51
608 0.47
609 0.44
610 0.43
611 0.46
612 0.46
613 0.48
614 0.44
615 0.43
616 0.4
617 0.35
618 0.34
619 0.28
620 0.27
621 0.24
622 0.23
623 0.21
624 0.18
625 0.16
626 0.15