Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067QER8

Protein Details
Accession A0A067QER8    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNKKAHRNGIKSPKGHydrophilic
NLS Segment(s)
PositionSequence
14-48KKAHRNGIKSPKGSRGQRTRSLKGVDAKFRRNARF
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKSPKGSRGQRTRSLKGVDAKFRRNARFAAIGSHKARVEQKEAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.8
5 0.76
6 0.77
7 0.8
8 0.78
9 0.72
10 0.67
11 0.65
12 0.65
13 0.63
14 0.62
15 0.61
16 0.6
17 0.65
18 0.69
19 0.64
20 0.61
21 0.58
22 0.53
23 0.5
24 0.49
25 0.49
26 0.47
27 0.49
28 0.51
29 0.55
30 0.54
31 0.49
32 0.45
33 0.4
34 0.4
35 0.36
36 0.37
37 0.35
38 0.39
39 0.38
40 0.42
41 0.38
42 0.36
43 0.42
44 0.38
45 0.39