Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067Q873

Protein Details
Accession A0A067Q873    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
219-250DRVRRMKEGERRTKIKTKKKLAKEQALRELWABasic
NLS Segment(s)
PositionSequence
222-241RRMKEGERRTKIKTKKKLAK
Subcellular Location(s) cyto 10.5, nucl 9.5, cyto_mito 7.333, mito_nucl 6.833, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021036  Ribosomal_S35_mit  
Pfam View protein in Pfam  
PF12298  Bot1p  
Amino Acid Sequences MHMEDPEKHSVRALSQKFGLSLKRVDAILRLKGLEAHWQKQELPLQTGFLAGMQKILGMVETPVLVGDRVDMDQADVVDELQGDEARDKYQRMFWETVSEGGEEPTLPGVLDRARADAVRFAETKEKAKSDNALLGITDKVAKGNDAVWEPTPQDWRARYEVLFYEPKVSSIDVLRAIAARPWSVTTPTNITIAKSGRGKYRPLIQFEDVGGKFLDVQDRVRRMKEGERRTKIKTKKKLAKEQALRELWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.39
4 0.38
5 0.4
6 0.38
7 0.32
8 0.32
9 0.29
10 0.29
11 0.27
12 0.26
13 0.29
14 0.3
15 0.3
16 0.29
17 0.27
18 0.24
19 0.26
20 0.26
21 0.3
22 0.31
23 0.31
24 0.33
25 0.34
26 0.34
27 0.38
28 0.43
29 0.36
30 0.34
31 0.31
32 0.29
33 0.27
34 0.26
35 0.21
36 0.16
37 0.14
38 0.09
39 0.09
40 0.08
41 0.07
42 0.07
43 0.07
44 0.05
45 0.04
46 0.05
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.08
74 0.1
75 0.11
76 0.12
77 0.15
78 0.18
79 0.23
80 0.24
81 0.23
82 0.26
83 0.25
84 0.26
85 0.23
86 0.2
87 0.15
88 0.13
89 0.13
90 0.08
91 0.07
92 0.06
93 0.05
94 0.04
95 0.04
96 0.05
97 0.05
98 0.08
99 0.08
100 0.09
101 0.09
102 0.1
103 0.1
104 0.12
105 0.13
106 0.13
107 0.13
108 0.13
109 0.19
110 0.2
111 0.23
112 0.22
113 0.22
114 0.21
115 0.22
116 0.23
117 0.18
118 0.2
119 0.17
120 0.15
121 0.14
122 0.13
123 0.12
124 0.1
125 0.1
126 0.06
127 0.06
128 0.06
129 0.07
130 0.06
131 0.07
132 0.09
133 0.1
134 0.11
135 0.11
136 0.13
137 0.13
138 0.15
139 0.17
140 0.16
141 0.19
142 0.19
143 0.22
144 0.24
145 0.25
146 0.23
147 0.23
148 0.24
149 0.24
150 0.25
151 0.21
152 0.23
153 0.21
154 0.22
155 0.2
156 0.19
157 0.15
158 0.14
159 0.16
160 0.12
161 0.12
162 0.12
163 0.11
164 0.11
165 0.12
166 0.12
167 0.1
168 0.1
169 0.11
170 0.12
171 0.15
172 0.16
173 0.17
174 0.2
175 0.21
176 0.24
177 0.22
178 0.22
179 0.23
180 0.24
181 0.26
182 0.26
183 0.28
184 0.32
185 0.35
186 0.38
187 0.38
188 0.47
189 0.47
190 0.48
191 0.52
192 0.45
193 0.45
194 0.42
195 0.46
196 0.36
197 0.32
198 0.26
199 0.2
200 0.19
201 0.18
202 0.21
203 0.14
204 0.2
205 0.26
206 0.33
207 0.37
208 0.38
209 0.4
210 0.39
211 0.48
212 0.53
213 0.56
214 0.6
215 0.66
216 0.69
217 0.74
218 0.8
219 0.81
220 0.81
221 0.81
222 0.81
223 0.82
224 0.87
225 0.91
226 0.92
227 0.92
228 0.91
229 0.9
230 0.89