Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PZ74

Protein Details
Accession A0A067PZ74   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
91-119PPPLVSAKLKPTRRMKKRLKRLVDTLSELHydrophilic
NLS Segment(s)
PositionSequence
86-111KRRSPPPPLVSAKLKPTRRMKKRLKR
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Pfam View protein in Pfam  
PF00856  SET  
Amino Acid Sequences MAGTQGPRMMFGPGRLVNHDCNPNSQLRHIPKTHSYQFITICPIALGESITVQYTAQGGFGSSGTAPEGTKCLCATCNPTNPPTLKRRSPPPPLVSAKLKPTRRMKKRLKRLVDTLSELLADG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.32
4 0.33
5 0.37
6 0.43
7 0.36
8 0.36
9 0.37
10 0.39
11 0.37
12 0.37
13 0.4
14 0.39
15 0.46
16 0.44
17 0.46
18 0.47
19 0.53
20 0.55
21 0.52
22 0.47
23 0.43
24 0.43
25 0.39
26 0.37
27 0.29
28 0.24
29 0.18
30 0.16
31 0.12
32 0.1
33 0.09
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.08
61 0.1
62 0.17
63 0.21
64 0.28
65 0.3
66 0.31
67 0.35
68 0.37
69 0.41
70 0.42
71 0.44
72 0.44
73 0.46
74 0.54
75 0.58
76 0.65
77 0.68
78 0.65
79 0.66
80 0.65
81 0.65
82 0.63
83 0.59
84 0.59
85 0.59
86 0.59
87 0.59
88 0.65
89 0.7
90 0.74
91 0.8
92 0.82
93 0.84
94 0.91
95 0.93
96 0.92
97 0.88
98 0.87
99 0.85
100 0.8
101 0.75
102 0.65
103 0.55