Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067Q1R6

Protein Details
Accession A0A067Q1R6    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-43EGAAAPKKRAPKKKKEETDEEABasic
63-104AEEEQPKKKRAPPKKRETAPAAEPKKRAPRKKKRLIELVLLLBasic
NLS Segment(s)
PositionSequence
9-36KPKRKRAATTKKAEGAAAPKKRAPKKKK
68-96PKKKRAPPKKRETAPAAEPKKRAPRKKKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MDDIEEEEKPKRKRAATTKKAEGAAAPKKRAPKKKKEETDEEAEDFTAAMDAVAVGDDDDHEAEEEQPKKKRAPPKKRETAPAAEPKKRAPRKKKRLIELVLLLVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.72
4 0.78
5 0.79
6 0.77
7 0.73
8 0.63
9 0.54
10 0.51
11 0.5
12 0.48
13 0.42
14 0.4
15 0.48
16 0.56
17 0.64
18 0.65
19 0.67
20 0.71
21 0.79
22 0.86
23 0.85
24 0.84
25 0.79
26 0.77
27 0.69
28 0.6
29 0.49
30 0.39
31 0.31
32 0.22
33 0.16
34 0.08
35 0.04
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.05
51 0.11
52 0.14
53 0.19
54 0.24
55 0.27
56 0.3
57 0.36
58 0.46
59 0.52
60 0.6
61 0.66
62 0.73
63 0.8
64 0.83
65 0.84
66 0.81
67 0.76
68 0.73
69 0.73
70 0.7
71 0.65
72 0.62
73 0.62
74 0.66
75 0.69
76 0.71
77 0.72
78 0.76
79 0.81
80 0.9
81 0.92
82 0.91
83 0.91
84 0.86
85 0.83
86 0.77