Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067PR38

Protein Details
Accession A0A067PR38    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
183-212AKTSHKSAGKGTKKKPKKAQKKLLSFGDDEHydrophilic
NLS Segment(s)
PositionSequence
172-174KRK
179-204LRDGAKTSHKSAGKGTKKKPKKAQKK
Subcellular Location(s) nucl 14, mito_nucl 12.333, mito 9.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPKDLTNAQLSSRLAYTAKTPAFLLKFQRRVAGEPESDEEEQDEEFEYVNDGSGRPPIPRRPPIPQRPKDQPGSAEEAERGDVDDDEKDEEAPQVVVLREGKHLSAWEAENEKRKAKGLPPLPDPSLPNPSLEASVSQGNDTLQPHQKPNKDDTGGLSFSSAKSLSKGSTKRKAIDDLRDGAKTSHKSAGKGTKKKPKKAQKKLLSFGDDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.19
4 0.2
5 0.23
6 0.23
7 0.22
8 0.22
9 0.26
10 0.28
11 0.31
12 0.38
13 0.39
14 0.45
15 0.45
16 0.51
17 0.47
18 0.47
19 0.48
20 0.45
21 0.37
22 0.33
23 0.35
24 0.33
25 0.32
26 0.28
27 0.24
28 0.18
29 0.17
30 0.14
31 0.12
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.08
38 0.08
39 0.07
40 0.07
41 0.11
42 0.12
43 0.13
44 0.19
45 0.26
46 0.35
47 0.42
48 0.46
49 0.53
50 0.62
51 0.7
52 0.76
53 0.75
54 0.74
55 0.76
56 0.77
57 0.73
58 0.65
59 0.57
60 0.5
61 0.5
62 0.43
63 0.34
64 0.28
65 0.24
66 0.21
67 0.18
68 0.14
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.07
85 0.08
86 0.09
87 0.1
88 0.11
89 0.11
90 0.1
91 0.1
92 0.09
93 0.1
94 0.1
95 0.1
96 0.13
97 0.15
98 0.22
99 0.24
100 0.25
101 0.24
102 0.25
103 0.25
104 0.26
105 0.32
106 0.32
107 0.35
108 0.38
109 0.42
110 0.42
111 0.41
112 0.4
113 0.35
114 0.34
115 0.28
116 0.24
117 0.21
118 0.2
119 0.19
120 0.17
121 0.14
122 0.1
123 0.12
124 0.12
125 0.11
126 0.11
127 0.1
128 0.12
129 0.13
130 0.16
131 0.2
132 0.22
133 0.29
134 0.35
135 0.4
136 0.41
137 0.45
138 0.49
139 0.44
140 0.43
141 0.41
142 0.4
143 0.35
144 0.32
145 0.27
146 0.2
147 0.18
148 0.19
149 0.15
150 0.1
151 0.11
152 0.12
153 0.14
154 0.21
155 0.29
156 0.36
157 0.46
158 0.51
159 0.54
160 0.57
161 0.63
162 0.62
163 0.63
164 0.6
165 0.56
166 0.54
167 0.5
168 0.47
169 0.4
170 0.41
171 0.35
172 0.33
173 0.35
174 0.34
175 0.35
176 0.42
177 0.51
178 0.54
179 0.61
180 0.67
181 0.7
182 0.77
183 0.86
184 0.89
185 0.89
186 0.9
187 0.92
188 0.93
189 0.93
190 0.93
191 0.92
192 0.9
193 0.83