Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067Q3L5

Protein Details
Accession A0A067Q3L5   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-107MSKPPLPCTPTKRRRRLPIHRHRSPRRRHCPRQDCPFPSRBasic
NLS Segment(s)
PositionSequence
79-95KRRRRLPIHRHRSPRRR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 2
Family & Domain DBs
Amino Acid Sequences MPAIVSPKPRYPISCLIDTPSMPFLHPSSMCWSSDSAMIPFQTATPVGGSRLMSPIHLSDSAARKSSMSKPPLPCTPTKRRRRLPIHRHRSPRRRHCPRQDCPFPSRGASAFDRLPWISRMEVSPSFSNVWDLADLSQLTADQPISSSLSGVGPIRSRKVSSRSHSLPFTRDDPTIPCDPLPSFDSAIVDLKSCPRTPSPRPLTPSQVRFQNLMPILLVELGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.45
4 0.46
5 0.42
6 0.38
7 0.32
8 0.27
9 0.22
10 0.23
11 0.19
12 0.22
13 0.22
14 0.22
15 0.25
16 0.27
17 0.27
18 0.26
19 0.26
20 0.21
21 0.24
22 0.23
23 0.18
24 0.17
25 0.17
26 0.16
27 0.15
28 0.14
29 0.12
30 0.1
31 0.1
32 0.09
33 0.09
34 0.1
35 0.12
36 0.12
37 0.12
38 0.15
39 0.14
40 0.13
41 0.14
42 0.14
43 0.14
44 0.14
45 0.13
46 0.16
47 0.22
48 0.23
49 0.24
50 0.23
51 0.21
52 0.25
53 0.32
54 0.35
55 0.35
56 0.4
57 0.44
58 0.49
59 0.54
60 0.54
61 0.52
62 0.52
63 0.58
64 0.61
65 0.66
66 0.72
67 0.74
68 0.81
69 0.85
70 0.88
71 0.88
72 0.89
73 0.89
74 0.88
75 0.9
76 0.9
77 0.89
78 0.88
79 0.88
80 0.88
81 0.89
82 0.9
83 0.91
84 0.91
85 0.9
86 0.89
87 0.87
88 0.81
89 0.74
90 0.67
91 0.57
92 0.48
93 0.41
94 0.31
95 0.25
96 0.21
97 0.2
98 0.17
99 0.16
100 0.17
101 0.15
102 0.16
103 0.13
104 0.13
105 0.11
106 0.11
107 0.11
108 0.14
109 0.15
110 0.17
111 0.16
112 0.16
113 0.17
114 0.16
115 0.17
116 0.12
117 0.12
118 0.09
119 0.09
120 0.07
121 0.08
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.04
130 0.05
131 0.06
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.09
138 0.09
139 0.1
140 0.12
141 0.14
142 0.17
143 0.18
144 0.2
145 0.24
146 0.3
147 0.37
148 0.4
149 0.47
150 0.49
151 0.52
152 0.55
153 0.53
154 0.49
155 0.44
156 0.42
157 0.35
158 0.31
159 0.28
160 0.26
161 0.28
162 0.29
163 0.26
164 0.23
165 0.22
166 0.22
167 0.24
168 0.23
169 0.21
170 0.19
171 0.18
172 0.19
173 0.18
174 0.21
175 0.17
176 0.16
177 0.14
178 0.18
179 0.22
180 0.22
181 0.24
182 0.28
183 0.36
184 0.42
185 0.52
186 0.56
187 0.6
188 0.65
189 0.67
190 0.7
191 0.71
192 0.71
193 0.66
194 0.65
195 0.59
196 0.56
197 0.51
198 0.5
199 0.42
200 0.37
201 0.31
202 0.23
203 0.21