Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PRW6

Protein Details
Accession A0A067PRW6   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-120MGSEYQPSQRKRKRKHGFLARKRSVTGRKILARRKLKQRKFLSHHydrophilic
NLS Segment(s)
PositionSequence
86-117RKRKRKHGFLARKRSVTGRKILARRKLKQRKF
Subcellular Location(s) mito 21, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRITKEVVRLLTRPPSLSIIRPRILLQKPCTIPSSSSLSSQIWHRFAPAFLPAILRQTLPFSPILSALQQVRYVTMGSEYQPSQRKRKRKHGFLARKRSVTGRKILARRKLKQRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.35
4 0.33
5 0.39
6 0.43
7 0.42
8 0.41
9 0.41
10 0.41
11 0.44
12 0.49
13 0.49
14 0.44
15 0.46
16 0.47
17 0.48
18 0.49
19 0.41
20 0.35
21 0.31
22 0.34
23 0.26
24 0.26
25 0.26
26 0.23
27 0.23
28 0.27
29 0.28
30 0.23
31 0.22
32 0.22
33 0.2
34 0.2
35 0.2
36 0.16
37 0.12
38 0.1
39 0.13
40 0.11
41 0.12
42 0.13
43 0.12
44 0.1
45 0.12
46 0.11
47 0.11
48 0.11
49 0.09
50 0.09
51 0.1
52 0.1
53 0.08
54 0.1
55 0.09
56 0.1
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.08
63 0.09
64 0.08
65 0.08
66 0.11
67 0.11
68 0.17
69 0.25
70 0.29
71 0.38
72 0.46
73 0.55
74 0.62
75 0.73
76 0.78
77 0.8
78 0.87
79 0.87
80 0.91
81 0.91
82 0.93
83 0.9
84 0.82
85 0.74
86 0.71
87 0.68
88 0.63
89 0.59
90 0.57
91 0.58
92 0.64
93 0.7
94 0.72
95 0.74
96 0.77
97 0.81
98 0.84
99 0.84
100 0.86